y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna24408.1-v1.0-hybrid
FamilyGT48
Protein PropertiesLength: 1661 Molecular Weight: 190110 Isoelectric Point: 8.5816
ChromosomeChromosome/Scaffold: 3 Start: 31045130 End: 31061896
Descriptionglucan synthase-like 10
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT48130715150
  LLQAIVTFLTMQFQLCSVFFTFSLGTKTHYFGRTILHGGAKYQATGRGFVVRHVKFTENYRLYSRSHFIKGLEVVLLLVVYLAYGYDDGGALSYILLTMT
  SWFMALSWLFAPYLFNPSGFEWQKVVEDFRDWTNWLLYRGGIGVKGEESWEAWWEEELSHIRTFSGRIAETILSLRFFIFQYGIIYRLDVKGSDTSLTVY
  GLSWIVFAV
GT4874212900
  VPRNLEARRRLQFFTNSLFMDMPEARPVREMLSFSVFTPYYAETVLYSIAELQKKNEDGISVLFYLQKIYPDEWKNFLSRIGRDENANDLELFDNPSDIL
  ELRFWASYRGQTLARTVRGMMYYRKALMLQTYLERLNSGVSDVEAAISSSDAAETRAFALSPEARAQADLKFTYVVTCQIYGKQKEGQKPEAADIALLMQ
  RNEALRVAFIDEVETLKDDGKVNREYYSKLVKADINGKDKEIYSIKLPGNPKIGEGKPENQNHAIVFTRGNAIQTIDMNQDNYFEEALKMRNLLEEFHRD
  HGLRRPTILGVREHVFTGSVSSLASFMCNQETSFVTLAQRVLANPLKVRMHYGHPDVFDRVFHITRGGISKASRVINISEDIFAGFNSTLRQGNVTHHEY
  IQVGKGRDVGLNQIAVFEGKVSGGNGEQVLSRDVYRLGQQFDFFRMLSFYFTTVGYYFCTLNVVGILLDFTVNCMLTVLMVYVFLYGKTYLALSGVGESL
  QNVASVTKNTALTAALNTQFLLQIGIFTAVPMILGFILEQGFLRYSKEE
Full Sequence
Protein Sequence     Length: 1661     Download
MAPSLSKNNA LDVTALVDSN VNSPLSITLQ GTNFLANGHP ILTEVPLNIT ATPLESVSKE    60
KKLLFASMYC LIWGEAANVR FLPECLCYIF HHMAREMDEI LRQQIAQPAN SCNSENGVSF    120
LDQVIYPLFE IVSAEAGNNE NGRAPHSAWR NYDDFNEYFC WPWRKGSSFF QKPTPRSKNI    180
LKSGRSQHRG KTSFVEHRTF LHLYHSFHRL WIFLVMMFQG LAIIAFNNQR FDAKCIREIL    240
SLGPTFVGMK FLESVLDVAM MYGAYSTSRS LAVSRIFLRF IWFGAASVVI SFLYVKALQE    300
ESKQNGNPVM YRLYLMIVGI YAGIQFFISF FMRIPACHSL TNQCDRWSLI RFVKWMRQER    360
YYVGRGMFER TTDFIKYMFF WLVILSGKFA FAYFLQIKPL VEPTTIIVNT NAITYTWHDL    420
VSGNNYNVLT VAALWAPVVV IYLLDLHVFY TLVSAVWGFL LGARDRLGEI RSLEALHKLF    480
EQFPGAFMDT LHIRLPNRAY HQSSSEDIEK NKVDASQFSP FWNEIINNLR EEDYITDLEM    540
ELLVMPKNSG NLPLVQWPLF LLASKIFIAK DIALESRDSQ DELWERISRD DYMKYAVQDC    600
FYSIKLILSE ILEGEGKMWV ERLYEDIRGS IVKKNIQADF QLNKLPLVIS RVTALMGILK    660
KGESSELVNG AVKAVQDLYD IVRHDVLSIN LREHYETWNL LSKARTEGRL FAKLKWPKDP    720
SLIAQVKRVY SLLTIQDSAA NVPRNLEARR RLQFFTNSLF MDMPEARPVR EMLSFSVFTP    780
YYAETVLYSI AELQKKNEDG ISVLFYLQKI YPDEWKNFLS RIGRDENAND LELFDNPSDI    840
LELRFWASYR GQTLARTVRG MMYYRKALML QTYLERLNSG VSDVEAAISS SDAAETRAFA    900
LSPEARAQAD LKFTYVVTCQ IYGKQKEGQK PEAADIALLM QRNEALRVAF IDEVETLKDD    960
GKVNREYYSK LVKADINGKD KEIYSIKLPG NPKIGEGKPE NQNHAIVFTR GNAIQTIDMN    1020
QDNYFEEALK MRNLLEEFHR DHGLRRPTIL GVREHVFTGS VSSLASFMCN QETSFVTLAQ    1080
RVLANPLKVR MHYGHPDVFD RVFHITRGGI SKASRVINIS EDIFAGFNST LRQGNVTHHE    1140
YIQVGKGRDV GLNQIAVFEG KVSGGNGEQV LSRDVYRLGQ QFDFFRMLSF YFTTVGYYFC    1200
TLNVVGILLD FTVNCMLTVL MVYVFLYGKT YLALSGVGES LQNVASVTKN TALTAALNTQ    1260
FLLQIGIFTA VPMILGFILE QGFLRYSKEE CMSLVITLLV KICHWFLLQA IVTFLTMQFQ    1320
LCSVFFTFSL GTKTHYFGRT ILHGGAKYQA TGRGFVVRHV KFTENYRLYS RSHFIKGLEV    1380
VLLLVVYLAY GYDDGGALSY ILLTMTSWFM ALSWLFAPYL FNPSGFEWQK VVEDFRDWTN    1440
WLLYRGGIGV KGEESWEAWW EEELSHIRTF SGRIAETILS LRFFIFQYGI IYRLDVKGSD    1500
TSLTVYGLSW IVFAVLIILF KVFTFSQKIS VNFQLLLRFI QGVSFMLALA GLAVAIKFTD    1560
LTIADVFASI LAFVPTGWGI LSICIAWKPL MKKLGVWKSI RSIALLYDAG MGMVIFIPIA    1620
LSSWFPFVST FQTRLMFNQA FSRGLEISVL LAGNNPNSGL *                        1680
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02711PLN027114.0e-1216161+
pfam14288FKS1_dom16.0e-4260164114+
pfam02364Glucan_synthase07421525870+
Gene Ontology
GO TermDescription
GO:00001481,3-beta-D-glucan synthase complex
GO:00038431,3-beta-D-glucan synthase activity
GO:0006075(1->3)-beta-D-glucan biosynthetic process
GO:0016020membrane
Transmembrane Domains
StartEnd
207226
239261
276298
310332
377395
439461
11871209
12161238
12621284
13051327
13691391
13981420
15031525
15341556
15611583
16031625
Hydropathy