y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna24562.1-v1.0-hybrid
FamilyGH35
Protein PropertiesLength: 2500 Molecular Weight: 347057 Isoelectric Point: 7.1913
ChromosomeChromosome/Scaffold: 1 Start: 12155038 End: 12180030
Descriptionbeta-galactosidase 7
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH35763770
  TIDGKRRILQSGSIHYPRSTPQMWPDLIRKSKEGGLDAIETYVFWNAHEPVRREYDFTGNLDLVRFLKTVQEEGLYAVLRIGPYVCAEWNYGGLPVWLHN
  LPNCQIRTANDVFMNEMKNFTTLIVDMMKKEKLFASQGGPIIIAQIENEYGNVESYYGDAGKAYINWCANFAESLNIGVPWIMCQQKDAPASMINTCNGW
  YCDTFKPSNPNTPKMWTENWTGWFKSWGGLDPLRTAEDVAFAVARFFQYGGTFQNYYMYHGGTNFDRTAASYITTSYDYDAPLDEYGHLNQPKWGHLKEL
  HE
Full Sequence
Protein Sequence     Length: 2500     Download
MGGKWRRGSF GMKRRRRKIS TTTPRRLEHY PSSSNLVTVH LINSVFCLIS TTLGRGNSGR    60
FVASATDVSY DGRAITIDGK RRILQSGSIH YPRSTPQMWP DLIRKSKEGG LDAIETYVFW    120
NAHEPVRREY DFTGNLDLVR FLKTVQEEGL YAVLRIGPYV CAEWNYGGLP VWLHNLPNCQ    180
IRTANDVFMN EMKNFTTLIV DMMKKEKLFA SQGGPIIIAQ IENEYGNVES YYGDAGKAYI    240
NWCANFAESL NIGVPWIMCQ QKDAPASMIN TCNGWYCDTF KPSNPNTPKM WTENWTGWFK    300
SWGGLDPLRT AEDVAFAVAR FFQYGGTFQN YYMYHGGTNF DRTAASYITT SYDYDAPLDE    360
YGHLNQPKWG HLKELHEVLK SMEHVLTYGN ITTTELGNSL STTVFATNES SGCIFGNANN    420
SVDATITFQG KTHTIPAWSV SILPDCKEEA YNTAKVNTQT TIKVKSVNKA EDELQSLQWS    480
WRPEKIHTEL LGKGEVVANR LMEQKEAAND ASDYLWYMTS VQISKDDPVL IGNMTLRINE    540
TGYILHAYVN GEHVGSQWAK YNVFNYVFEK PITLVPGVNT ISLLSATVGF PNYGGGFEDI    600
KTGIVGPVEL VGQSGDETVI KNLSERKWSY KVGLHGMKDQ LFSSASRKWS VEGLPVNRTM    660
TWYKTTFKAP LGTEPVVVDL QGLGKGNAWV NGHSIGRYWP SYLAQTDGCS LQACDYRGTY    720
DNNKCVFNCG KPTQRWYHIP RSFLQDDENT LVLFEEFGGN PSYVNFQTIR VGTICANAYE    780
NHTLKLACQG RPISAIKFAS FGNPEGTCGS FRKGTCDSTT ALSILQKECV GKESCSIDVS    840
ESMFGYTTCG DIMKRLAVEA RAKSRSRSLW KVNKNLPPRA STCIRNGIER HRLCGVQATH    900
QKVGPRQTAT WSSRSTERFI PQVEQLKSNS PILYTQCDAR FSDRGKEQYN TLPGDLFILA    960
NAKPEPISEI QLTGRSWSFA SVTHLVSSIS QIQETDGNGD VVEVEDVEEG TSLCFKIESS    1020
KEFEVDDSTS LFVAFLLNLI PSRRICNALQ MSGNLKIIKE VLCPDSVAQE NLSYKKNNDI    1080
MEKGLDDNFL SGLNKAQSGA VLACLGMLHH DAKSSVELVW GPPGTGKTKT IATLLFTLLK    1140
MNCRTLVCAP TNVAITEVAA RLLKLVTEEQ SNAMFCSLGE ILLFGDKERI KLKVGSNIED    1200
LYLGHRIQRL IECLGPQTGW RHCFASMINL LEHCVCHYNI YLANELTKER EQNSVCEMNN    1260
ESRSEPEFSE RKCKTFIEYF RDTFVSTATP LKYCISIFST HISKYCISEH IFSDMVSLIL    1320
LVDSFEMLLF ECNVHSEALE GLFSCSEVGA ASELYMVHSI PLFIQRRECL AALRALQCSL    1380
SELELPDFRD ESDLMDLCFQ SASLVLCTAS SSFKLHRAEI SFTIVVIDEA AQLKECESTI    1440
PLQLPGVRHV VLVGDECQLL AMVKSNVSRE SGFARSLFDR LSSMGHPKHL LDMQYRMQPS    1500
ISCFPNSCFY NNRILDAPNV TQKSHEKHHL PGPMFGPYSF INVNDGREDK DENGHSRKNI    1560
VEVSIVLKVL RNLYKGTLDF CFILARSHIP DVGYISQQYF SKMPDGSDKF LKSFKKLKSA    1620
SVKKSALNLL LKLSSGWRPN KRSVETSCGS SSIILKKFKV KYLYIVCTTD IAEDVRYVQV    1680
LKVWDILPLE DIPKLVYRLE TILNRYTDAF INLCKEKYFE GNLEVPQALE FSRFKDPSVT    1740
ETKGDFFSDT SDSRSYVENS QVSESLLLMK FYSLSSGVVN HLLSDREGRE LDLPFEVTDQ    1800
EMEIIIQHRS SFIVGRSGTG KTTGLTMKLF QKEQWHHLAL QGCSVIENST AEQSSAATEG    1860
KVIRQLFVTV SPKLCFAIKQ HVTHLKRFAC GGSHSAQRSL IDMIDFDEEE SQFKDIQDSF    1920
HDIPPSYYPL VITFHKFLMM LDGTLSNSYF SRFQDASIPH DQLRNSRSVA FQAFFRTKEV    1980
NYEQFSSLYW PHFNTQLTKN LDAACVFTEI ISHIKGGLGA IEACDGKLSQ EDYVKLSEGR    2040
SSDITKPKRE QIYEIFQDYE KMKMGNGEFD MADFVIDLQR RLKHEKYVGD QMDFIYIDEV    2100
KDLTMSQLAL FKHMCNTVDE GFVFSGDTAQ TIARGTDFRF QDIRHLFYKN LCWSQELISM    2160
RIEKTKGQIS EVYHLTQNIH THAGILKLSQ SIIELIYRFF PFSIDVLKPE SSLIYGEAPV    2220
VLESGENENA IIKRFGNSGN IVGFGAEPDV KRTVRTRLKV WTSVRSPPSS AGDGAPPPQK    2280
TLAASPTTFP PRRVHSFPDV LLYNFFSSSP LRNQWRVIYD YMKEQDLLDS TLPKKFPSFN    2340
EAKHNILCSE LKQLYVAVTR TRQRLWVCET VHEHSKPMID YWKKKCLVQV RQLDDSLAQA    2400
MQVASSTEEW RSREIKLYHA NKYGMATLCF ERAGDTYWEQ RSKAAGLKAI ADRMRMSNPG    2460
EANSILKEAA EIFDAIGKAD SAARCFSDLG EYERAARIYF                          2520
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG1112COG11123.0e-1914021584185+
COG1874LacA9.0e-2568369358+
pfam13087AAA_122.0e-2514731589119+
pfam01301Glyco_hydro_353.0e-15174376319+
PLN03059PLN03059043860847+
Gene Ontology
GO TermDescription
GO:0003677DNA binding
GO:0004003ATP-dependent DNA helicase activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004565beta-galactosidase activity
GO:0005524ATP binding
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3d3a_A5.04467e-447740717350A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB4e8d_B2e-377736312314A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB4e8d_A2e-377736312314A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB4e8c_B2e-377736312314A Chain A, Crystal Structure Of Streptococcal Beta-Galactosidase In Complex With Galactose
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_001_00780.9Aquca_001_00780.8Aquca_001_00780.7Aquca_001_00780.6Aquca_001_00780.5
Aquca_001_00780.4Aquca_001_00780.3Aquca_001_00780.2Aquca_001_00780.1Aquca_034_00110.4
Aquca_034_00110.3Aquca_034_00110.1Aquca_020_00465.4Aquca_020_00465.3Aquca_020_00465.2
Aquca_020_00465.1Aquca_010_00597.2Aquca_010_00597.1Aquca_001_00069.5Aquca_001_00069.4
Aquca_001_00069.3Aquca_001_00069.2Aquca_001_00069.1Aquca_007_00320.5Aquca_007_00320.4
Aquca_007_00320.3Aquca_007_00320.2Aquca_007_00320.1Aquca_014_00261.6Aquca_014_00261.5
Aquca_014_00261.3Aquca_014_00261.1Aquca_076_00042.1Aquca_014_00261.2
Arabidopsis lyrata481656902346897617491000485655
313754351167492198473836885868
919677
Arabidopsis thalianaAT2G28470.2AT2G28470.1AT2G32810.2AT2G32810.1AT3G13750.1
AT4G36360.2AT4G36360.1AT3G52840.1AT1G45130.1AT5G20710.1
AT4G26140.2AT4G26140.1AT1G31740.1AT5G56870.1AT5G63810.1
Brachypodium distachyonBradi1g67760.1Bradi4g07990.3Bradi4g07990.2Bradi4g07990.1Bradi3g08180.1
Bradi1g74050.1Bradi1g37450.1Bradi2g41830.1Bradi2g56607.1Bradi2g40450.1
Bradi3g49460.1
Brassica rapaBra011946Bra000493Bra021814Bra027403Bra011677
Bra036334Bra002325Bra006850Bra021506Bra019644
Bra035634Bra014036Bra019120Bra024238
Carica papayaevm.model.supercontig_216.21evm.model.supercontig_25.57evm.model.supercontig_93.34evm.TU.contig_32583.1evm.model.supercontig_6.189
evm.model.supercontig_28.1evm.model.supercontig_99.11evm.model.supercontig_24.26evm.model.supercontig_28.48evm.model.supercontig_18.155
evm.model.supercontig_37.20
Capsella rubellaCarubv10025350mCarubv10025536mCarubv10011312mCarubv10016323mCarubv10004155m
Carubv10004117mCarubv10008424mCarubv10007108mCarubv10003630mCarubv10025963m
Carubv10025947m
Citrus clementinaCiclev10027805mCiclev10004268mCiclev10024888mCiclev10024886mCiclev10000260m
Ciclev10017808mCiclev10024881mCiclev10007628mCiclev10007573mCiclev10007531m
Ciclev10010771mCiclev10010541mCiclev10030257mCiclev10010454mCiclev10010258m
Ciclev10000393mCiclev10018839m
Citrus sinensisorange1.1g009890morange1.1g006249morange1.1g003147morange1.1g003095morange1.1g038226m
orange1.1g005416morange1.1g003498morange1.1g003137morange1.1g002867morange1.1g006635m
orange1.1g004777morange1.1g003649morange1.1g003585morange1.1g003076morange1.1g037925m
orange1.1g006904morange1.1g003490morange1.1g003044morange1.1g007390morange1.1g007388m
orange1.1g006681morange1.1g006349morange1.1g005319morange1.1g005182morange1.1g004677m
orange1.1g004219morange1.1g039348morange1.1g046585morange1.1g005160morange1.1g005690m
orange1.1g037832morange1.1g004525morange1.1g036343morange1.1g045354morange1.1g004605m
orange1.1g046146m
Cucumis sativusCucsa.256570.1Cucsa.207240.3Cucsa.207240.2Cucsa.207240.1Cucsa.043260.3
Cucsa.043260.1Cucsa.397370.7Cucsa.397370.6Cucsa.397370.4Cucsa.397370.3
Cucsa.397370.2Cucsa.201100.1Cucsa.229010.3Cucsa.229010.1Cucsa.397370.5
Cucsa.397380.7Cucsa.397380.4Cucsa.397380.3Cucsa.397380.2Cucsa.397380.1
Cucsa.014950.1Cucsa.228210.1Cucsa.182050.1Cucsa.342700.5Cucsa.342700.3
Cucsa.342700.2Cucsa.342700.1Cucsa.356120.1Cucsa.254230.1Cucsa.397400.1
Cucsa.043260.2Cucsa.141960.1Cucsa.109300.1Cucsa.397370.1Cucsa.128820.1
Eucalyptus grandisEucgr.J00936.1Eucgr.F01855.1Eucgr.H00038.1Eucgr.D00703.2Eucgr.D00703.1
Eucgr.C00898.2Eucgr.C00898.1Eucgr.I02384.1Eucgr.C03662.1Eucgr.G01704.2
Eucgr.G01704.1Eucgr.F03130.2Eucgr.F03130.1Eucgr.J02867.4Eucgr.J02867.3
Eucgr.J02867.2Eucgr.J02867.1Eucgr.C03896.1Eucgr.A01583.1Eucgr.C03897.1
Eucgr.I00108.1Eucgr.C03898.1Eucgr.C00782.1
Fragaria vescamrna04817.1-v1.0-hybridmrna14907.1-v1.0-hybridmrna23065.1-v1.0-hybridmrna21868.1-v1.0-hybridmrna12627.1-v1.0-hybrid
mrna12626.1-v1.0-hybridmrna30476.1-v1.0-hybridmrna12914.1-v1.0-hybridmrna12920.1-v1.0-hybrid
Glycine maxGlyma08g11670.1Glyma13g40200.2Glyma13g40200.1Glyma11g20730.1Glyma12g29660.1
Glyma11g16010.1Glyma08g20650.1Glyma15g02750.1Glyma07g01250.1Glyma13g42680.1
Glyma04g03120.1Glyma01g37541.1Glyma11g07760.1Glyma14g07700.1Glyma17g37270.3
Glyma17g37270.2Glyma02g05790.1Glyma02g07770.1Glyma16g24440.1Glyma02g07740.1
Glyma13g17240.1Glyma17g06280.1Glyma09g07100.1Glyma09g21970.1Glyma15g18430.5
Glyma15g18430.4Glyma15g18430.2Glyma17g05250.1Glyma16g09490.1Glyma07g12010.1
Glyma07g12060.1Glyma04g38590.1Glyma06g16420.2Glyma06g03160.1Glyma16g05320.2
Gossypium raimondiiGorai.009G078400.2Gorai.009G078400.1Gorai.011G155500.3Gorai.011G155500.2Gorai.011G155500.1
Gorai.009G140800.1Gorai.001G011600.3Gorai.001G011600.2Gorai.001G011600.1Gorai.010G007300.4
Gorai.010G007300.3Gorai.010G007300.2Gorai.010G007300.1Gorai.009G198100.2Gorai.009G198100.1
Gorai.011G065300.3Gorai.011G065300.2Gorai.011G065300.1Gorai.003G011900.1Gorai.010G082900.7
Gorai.010G082900.6Gorai.010G082900.5Gorai.010G082900.4Gorai.010G082900.3Gorai.010G082900.2
Gorai.010G082900.1Gorai.011G021800.1Gorai.007G198900.7Gorai.007G198900.6Gorai.007G198900.5
Gorai.007G198900.4Gorai.007G198900.3Gorai.007G198900.2Gorai.007G198900.1Gorai.005G246600.4
Gorai.005G246600.3Gorai.005G246600.2Gorai.005G246600.1Gorai.008G000600.3Gorai.008G000600.2
Gorai.008G000600.1Gorai.009G140800.2Gorai.013G222800.1Gorai.011G065300.4Gorai.003G059500.1
Gorai.013G216400.1Gorai.013G261500.1Gorai.008G221000.1
Linum usitatissimumLus10016655Lus10015625Lus10037644Lus10000701Lus10025980
Lus10024292Lus10041798Lus10028348Lus10040557Lus10006009
Lus10028848Lus10008974.310.612Lus10008974.310.612Lus10008974.310.612Lus10006733
Lus10000803Lus10014278Lus10022645Lus10003343Lus10025108.641.935
Lus10025108.641.935Lus10025108.641.935
Malus domesticaMDP0000271897MDP0000265046MDP0000030527MDP0000151981MDP0000416548
MDP0000188563MDP0000899966MDP0000310582MDP0000227393MDP0000201058
MDP0000195063MDP0000133794MDP0000180588MDP0000202465
Manihot esculentacassava4.1_031695mcassava4.1_001639mcassava4.1_001637mcassava4.1_001503mcassava4.1_021365m
cassava4.1_001635mcassava4.1_001624mcassava4.1_001621mcassava4.1_003430mcassava4.1_001885m
cassava4.1_001652mcassava4.1_002442mcassava4.1_031472mcassava4.1_021879mcassava4.1_023022m
cassava4.1_001733mcassava4.1_029381mcassava4.1_025948m
Medicago truncatulaMedtr2g094060.1Medtr2g094070.1Medtr4g059680.1Medtr8g085210.1Medtr2g100110.1
Medtr2g094020.1Medtr1g023120.1Medtr5g021190.1Medtr2g039120.2Medtr2g039120.1
Medtr5g024080.1Medtr2g042610.1Medtr3g005570.1Medtr1g018200.1Medtr3g096900.2
Medtr3g096900.1Medtr5g025830.1
Mimulus guttatusmgv1a001399mmgv1a001263mmgv1a001990mmgv1a001293mmgv1a001258m
mgv1a001958mmgv1a001956mmgv1a001295mmgv1a003101mmgv1a001274m
mgv1a001299mmgv1a024117mmgv1a001416mmgv1a026608mmgv1a001605m
mgv1a001631mmgv1a001413mmgv1a001532m
Oryza sativaLOC_Os03g15020.1LOC_Os12g24170.1LOC_Os06g37560.1LOC_Os02g12730.3LOC_Os02g12730.2
LOC_Os02g12730.1LOC_Os03g06940.2LOC_Os03g06940.1LOC_Os01g39830.1LOC_Os03g15020.2
LOC_Os01g65460.2LOC_Os01g65460.1LOC_Os01g34920.1LOC_Os10g18400.1LOC_Os10g19960.1
LOC_Os06g42310.1
Panicum virgatumPavirv00010319mPavirv00012002mPavirv00013315mPavirv00037614mPavirv00065729m
Pavirv00038061mPavirv00063900mPavirv00063103mPavirv00033311m
Physcomitrella patensPp1s10_144V6.1Pp1s24_113V6.1Pp1s189_71V6.1Pp1s189_65V6.1
Phaseolus vulgarisPhvul.004G096800.1Phvul.003G050100.1Phvul.011G077600.1Phvul.011G074300.1Phvul.011G074900.1
Phvul.009G012700.1Phvul.005G160000.1Phvul.010G139300.1Phvul.002G167200.1Phvul.003G258300.1
Phvul.001G010900.1Phvul.009G232500.1Phvul.003G137000.1Phvul.009G153100.1Phvul.011G075900.1
Picea abiesMA_72251g0010MA_98513g0010MA_10427427g0010MA_10428400g0010
Populus trichocarpaPotri.009G012400.6Potri.009G012400.5Potri.009G012400.4Potri.009G012400.3Potri.009G012400.2
Potri.009G012400.1Potri.017G057900.1Potri.005G232600.1Potri.001G200400.3Potri.001G200400.1
Potri.006G144500.5Potri.006G144500.4Potri.006G144500.3Potri.006G144500.2Potri.006G144500.1
Potri.003G038500.4Potri.003G038500.3Potri.003G038500.2Potri.003G038500.1Potri.007G018100.7
Potri.007G018100.6Potri.007G018100.5Potri.007G018100.4Potri.007G018100.2Potri.007G018100.1
Potri.004G159800.1Potri.011G044300.2Potri.011G044300.1Potri.006G139100.3Potri.001G025700.1
Potri.001G025800.1Potri.T154000.1Potri.006G139100.1Potri.018G062800.1Potri.007G099800.1
Potri.001G200400.2Potri.004G159800.2Potri.006G139100.2Potri.007G099800.2
Prunus persicappa001149mppa002271mppa001412mppa001334mppa001382m
ppa001415mppa001340mppa001363mppa001345mppa020752m
ppa001480mppa001479m
Ricinus communis28076.m00042829904.m00289929739.m00372030170.m01410828694.m000675
29917.m00196129739.m00374030131.m00709429912.m00532330193.m000718
29912.m00532429815.m000493
Setaria italicaSi021080mSi034234mSi034250mSi034249mSi000317m
Si000291mSi016472m
Selaginella moellendorffii269483404798413650
Sorghum bicolorSb08g004410.1Sb01g040750.1Sb04g007660.1Sb10g022620.1Sb01g046160.1
Sb03g025990.1Sb03g041450.1Sb03g023500.1
Thellungiella halophilaThhalv10016234mThhalv10016215mThhalv10020056mThhalv10024679mThhalv10024387m
Thhalv10006871mThhalv10011265mThhalv10024511mThhalv10012695mThhalv10012847m
Thhalv10010152mThhalv10003705m
Vitis viniferaGSVIVT01020995001GSVIVT01025170001GSVIVT01016849001GSVIVT01018853001GSVIVT01009791001
GSVIVT01024221001GSVIVT01015203001GSVIVT01015038001GSVIVT01022339001GSVIVT01033736001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)