y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna24696.1-v1.0-hybrid
FamilyGT1
Protein PropertiesLength: 241 Molecular Weight: 26847.9 Isoelectric Point: 4.8812
ChromosomeChromosome/Scaffold: 2 Start: 8332542 End: 8334486
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT1252146.1e-39
  DRYESVVKWLDDQPPSSVVLLCFGSMGSLNGPQVREIAFGLERAGFRFLWALREPPKSNVYLPTDPTNVDEVLPDGFLEQTCKLGLVCGWVPQVKILAHQ
  AIGGFVSHCGWNSILESLWYGVPIATWPIYAEQQMNAFEMVKELGLAVEIRVDYREGSKIVMAEEVERSIKRLMDGDHGVRTRVKDMREK
Full Sequence
Protein Sequence     Length: 241     Download
MVKASPIPAT SGWKSSEGYG SLNPDRYESV VKWLDDQPPS SVVLLCFGSM GSLNGPQVRE    60
IAFGLERAGF RFLWALREPP KSNVYLPTDP TNVDEVLPDG FLEQTCKLGL VCGWVPQVKI    120
LAHQAIGGFV SHCGWNSILE SLWYGVPIAT WPIYAEQQMN AFEMVKELGL AVEIRVDYRE    180
GSKIVMAEEV ERSIKRLMDG DHGVRTRVKD MREKSRMALM ENGSAYQALE DLIEELLPKV    240
*                                                                    300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN03004PLN030044.0e-5323228207+
PLN02207PLN022074.0e-8126237214+
PLN00164PLN001644.0e-9231240215+
PLN02167PLN021672.0e-9822237217+
PLN02554PLN025544.0e-10030236213+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2acw_B022236258461A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB2acw_A022236258461A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB2acv_B022236258461A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB2acv_A022236258461A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB2vg8_A1.96182e-4431229259460A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_028_00243.1Aquca_020_00570.1Aquca_016_00047.1Aquca_016_00048.1
Arabidopsis lyrata470743887936901945856204481887
481893901948470742898631479701
493362915287333019479703898625
493361342328
Arabidopsis thalianaAT2G29730.1AT1G07260.1AT1G07250.1AT2G29710.1AT2G29740.1
AT2G29750.1AT1G07240.1AT3G21790.1AT3G21800.1AT4G15280.1
AT3G21760.1AT3G21780.1AT4G15260.1AT3G21750.1
Brachypodium distachyonBradi1g26760.1Bradi2g08310.1Bradi1g23110.1Bradi1g24660.1Bradi1g26750.1
Bradi1g26790.1Bradi1g26770.1Bradi1g24667.1
Brassica rapaBra015568Bra007812Bra018364Bra018363Bra031559
Bra000471Bra015567Bra039557Bra031303Bra001845
Bra012795Bra001847Bra001846Bra023863Bra031304
Bra031307Bra031310Bra031561Bra031306Bra023861
Carica papayaevm.model.supercontig_8.229evm.model.supercontig_8.271evm.model.supercontig_8.227evm.model.supercontig_8.266evm.model.supercontig_1056.1
Capsella rubellaCarubv10009021mCarubv10009025mCarubv10009037mCarubv10025242mCarubv10023111m
Carubv10016887mCarubv10015440mCarubv10013556mCarubv10007776mCarubv10004730m
Carubv10026313mCarubv10013615mCarubv10013591mCarubv10013590mCarubv10015093m
Carubv10015326mCarubv10016519m
Citrus clementinaCiclev10011659mCiclev10014993mCiclev10013653mCiclev10018337mCiclev10011544m
Ciclev10011522m
Citrus sinensisorange1.1g045570morange1.1g043290morange1.1g011311morange1.1g045029morange1.1g047945m
Cucumis sativusCucsa.058290.1Cucsa.134570.1Cucsa.058370.1Cucsa.058340.1Cucsa.058380.1
Cucsa.058390.1Cucsa.058360.1Cucsa.058400.1Cucsa.058480.1
Eucalyptus grandisEucgr.J01922.1Eucgr.E04316.1Eucgr.E04315.1Eucgr.K01350.1Eucgr.L01241.1
Eucgr.A00945.1Eucgr.A00935.1Eucgr.A00926.1Eucgr.A00940.1Eucgr.A00934.1
Eucgr.A00919.1Eucgr.A00936.1Eucgr.A00938.1Eucgr.A00933.1Eucgr.A00920.1
Eucgr.A00937.1Eucgr.A00927.1Eucgr.A00932.1Eucgr.A00942.1Eucgr.A00947.1
Eucgr.A00930.1Eucgr.A00929.1Eucgr.C01648.1Eucgr.A00948.1Eucgr.A00943.1
Eucgr.A00917.1
Fragaria vescamrna24227.1-v1.0-hybridmrna07876.1-v1.0-hybridmrna22710.1-v1.0-hybridmrna22709.1-v1.0-hybridmrna19965.1-v1.0-hybrid
mrna24226.1-v1.0-hybridmrna24225.1-v1.0-hybridmrna20181.1-v1.0-hybridmrna24224.1-v1.0-hybridmrna22597.1-v1.0-hybrid
mrna24695.1-v1.0-hybridmrna19964.1-v1.0-hybrid
Glycine maxGlyma02g39080.2Glyma02g39090.2Glyma02g39090.1Glyma14g37170.1Glyma09g09910.1
Glyma02g47990.1
Gossypium raimondiiGorai.009G071600.1Gorai.013G260500.2Gorai.001G214000.1Gorai.003G149300.1Gorai.013G260500.1
Gorai.008G051100.1Gorai.008G051000.1Gorai.005G073700.1Gorai.001G214300.1Gorai.009G071500.1
Gorai.003G123200.1Gorai.008G051000.2Gorai.005G073500.1
Linum usitatissimumLus10026793Lus10039037Lus10026795Lus10036087Lus10027334
Lus10036088Lus10036086Lus10003805Lus10010476
Malus domesticaMDP0000215525MDP0000092033MDP0000163017MDP0000323136MDP0000735095
MDP0000553484MDP0000426138MDP0000715898MDP0000058337MDP0000307237
MDP0000290801MDP0000242552MDP0000306121MDP0000769764MDP0000899508
MDP0000584567MDP0000873295MDP0000806350MDP0000238976MDP0000437996
MDP0000122122
Manihot esculentacassava4.1_032692mcassava4.1_006457mcassava4.1_031134mcassava4.1_031478mcassava4.1_006857m
cassava4.1_007027mcassava4.1_007099mcassava4.1_027138mcassava4.1_007029mcassava4.1_025684m
cassava4.1_018585m
Medicago truncatulaMedtr5g070090.1Medtr5g090670.1Medtr5g070040.1Medtr5g090630.1Medtr5g098930.1
Medtr5g090660.1Medtr5g090620.1Medtr5g090700.1Medtr5g090610.1Medtr5g090580.1
Medtr5g090600.1Medtr5g090690.1
Mimulus guttatusmgv1a005089mmgv1a025629mmgv1a003831mmgv1a023772mmgv1a020444m
mgv1a004831m
Oryza sativaLOC_Os07g32060.1LOC_Os07g32020.1LOC_Os07g31960.1LOC_Os07g32620.1LOC_Os07g37690.1
LOC_Os07g32630.1LOC_Os07g32010.1
Panicum virgatumPavirv00038813mPavirv00046201mPavirv00060850mPavirv00004183mPavirv00042016m
Pavirv00013870mPavirv00052098mPavirv00011477mPavirv00011783mPavirv00046092m
Pavirv00031799mPavirv00064006mPavirv00050397mPavirv00067120mPavirv00059544m
Phaseolus vulgarisPhvul.008G262100.1Phvul.008G262000.1Phvul.009G218800.1Phvul.008G290300.1Phvul.008G290200.1
Populus trichocarpaPotri.016G016900.1Potri.009G044600.1Potri.009G044600.2Potri.016G015700.1Potri.016G015800.1
Potri.006G010000.1Potri.016G014500.1Potri.016G014100.1Potri.016G014400.1Potri.016G014300.1
Potri.016G017300.1Potri.016G014500.2Potri.006G007000.1Potri.016G016500.1Potri.016G017100.1
Potri.016G016000.1Potri.016G017200.1Potri.006G007100.1Potri.006G007300.1Potri.016G016800.1
Potri.014G026300.1Potri.016G017400.1Potri.016G016700.1Potri.016G016300.1Potri.016G016100.1
Potri.016G016200.1Potri.006G007200.1Potri.006G007400.1Potri.016G016400.1Potri.016G017000.1
Potri.006G007600.1
Prunus persicappa004906mppa007869mppa024083mppa018557mppa005052m
ppa005290mppa004957mppa021727mppa005277mppa004725m
ppa025943mppa018805m
Ricinus communis29681.m00133029681.m00133129994.m00046129724.m00084629724.m000844
Setaria italicaSi029670mSi029690mSi031935mSi029664mSi029787m
Si029659mSi032839mSi029729mSi027371m
Sorghum bicolorSb02g034150.1Sb10g004240.1Sb02g034110.1Sb02g034120.1Sb02g034130.1
Sb10g004230.1Sb06g020440.1Sb02g034160.1Sb02g034140.1Sb02g034170.1
Sb02g034100.1Sb02g011220.1Sb07g002380.1
Thellungiella halophilaThhalv10009289mThhalv10007440mThhalv10007519mThhalv10025075mThhalv10020645m
Thhalv10021907mThhalv10020628m
Vitis viniferaGSVIVT01029671001GSVIVT01029680001GSVIVT01015859001GSVIVT01036732001GSVIVT01023095001
GSVIVT01023005001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)