y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna24756.1-v1.0-hybrid
FamilyGT76
Protein PropertiesLength: 372 Molecular Weight: 41752.8 Isoelectric Point: 9.1042
ChromosomeChromosome/Scaffold: 3 Start: 28130924 End: 28133208
Descriptiontransferases, transferring hexosyl groups
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT76133540
  VIKYAIRSRLLVLSLIILWRTLLTPYDTSAPLNPTCLSQQQHPNVVADDDQHVILVPRLASAIESSIVWDSVYFVRIAQCGYEYEQSYAFFPLLPICISW
  LSRKVLAPLIPVIGHRAVLGLSGYVINNVGFVFAALYLYRLSVIILKDQEAALRASILFCFNPASIFYSSIYSETLFALFSLGGLYHLMSGKNTIAVLWL
  ALSGFSRSNGMLNAGYFCFQTMHQAYDAVFLRKRAFVLVGGALRCICIFVPFVAFQSYGYHNICLGHFPNETSPWCKARVPMLYNYIQNHYWGVGFLKYF
  QVKQLPNFLLASPILSLALCSIVHYAKSNPKNFYSLGFHAPT
Full Sequence
Protein Sequence     Length: 372     Download
MMNPTKSHHE STVIKYAIRS RLLVLSLIIL WRTLLTPYDT SAPLNPTCLS QQQHPNVVAD    60
DDQHVILVPR LASAIESSIV WDSVYFVRIA QCGYEYEQSY AFFPLLPICI SWLSRKVLAP    120
LIPVIGHRAV LGLSGYVINN VGFVFAALYL YRLSVIILKD QEAALRASIL FCFNPASIFY    180
SSIYSETLFA LFSLGGLYHL MSGKNTIAVL WLALSGFSRS NGMLNAGYFC FQTMHQAYDA    240
VFLRKRAFVL VGGALRCICI FVPFVAFQSY GYHNICLGHF PNETSPWCKA RVPMLYNYIQ    300
NHYWGVGFLK YFQVKQLPNF LLASPILSLA LCSIVHYAKS NPKNFYSLGF HAPTEDKSSA    360
AVLFTLSRGN I*                                                        420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG5542COG55423.0e-24101327231+
pfam04188Mannosyl_trans24.0e-9937340314+
Gene Ontology
GO TermDescription
GO:0005789endoplasmic reticulum membrane
GO:0006506GPI anchor biosynthetic process
GO:0016021integral to membrane
GO:0016758transferase activity, transferring hexosyl groups
Transmembrane Domains
StartEnd
1335
136158
170192
207229
249271
316338
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_013_00449.3Aquca_013_00449.2Aquca_013_00449.1
Arabidopsis lyrata471336
Arabidopsis thalianaAT1G11880.1
Brachypodium distachyonBradi4g06960.1
Brassica rapaBra031787Bra016807
Carica papayaevm.model.supercontig_1833.2
Capsella rubellaCarubv10008966m
Chlamydomonas reinhardtiiCre07.g320650.t1.3
Citrus clementinaCiclev10015009m
Citrus sinensisorange1.1g018572morange1.1g020868morange1.1g022022morange1.1g011059m
Cucumis sativusCucsa.142860.1Cucsa.142850.1
Eucalyptus grandisEucgr.F02225.1
Glycine maxGlyma07g34710.2Glyma07g34710.1
Gossypium raimondiiGorai.011G002800.4.154.470Gorai.011G002800.6Gorai.011G002800.3Gorai.011G002800.2Gorai.011G002800.4.154.470
Gorai.011G002800.5Gorai.011G002800.4.21.155Gorai.011G002800.1Gorai.011G002800.4.21.155
Linum usitatissimumLus10000535
Malus domesticaMDP0000302238MDP0000268496MDP0000210920MDP0000206274MDP0000255613
MDP0000165902
Manihot esculentacassava4.1_021982mcassava4.1_013936m
Medicago truncatulaMedtr4g084070.1
Mimulus guttatusmgv1a006152m
Oryza sativaLOC_Os12g31480.1
Panicum virgatumPavirv00004639mPavirv00008794m
Physcomitrella patensPp1s58_115V6.1
Phaseolus vulgarisPhvul.002G098000.2Phvul.009G191800.1Phvul.002G098000.1
Picea abiesMA_93868g0010MA_10427477g0010
Populus trichocarpaPotri.003G216900.1Potri.003G216900.3Potri.003G216900.2Potri.003G216900.4Potri.003G216900.5
Prunus persicappa004654m
Ricinus communis29692.m000527
Setaria italicaSi021856m
Selaginella moellendorffii268247
Sorghum bicolorSb03g024000.1
Thellungiella halophilaThhalv10007452m
Vitis viniferaGSVIVT01025407001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny