y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna24842.1-v1.0-hybrid
FamilyCBM57
Protein PropertiesLength: 1790 Molecular Weight: 197989 Isoelectric Point: 7.5701
ChromosomeChromosome/Scaffold: 3 Start: 3842654 End: 3876379
DescriptionLeucine-rich repeat transmembrane protein kinase
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM573244496.3e-21
  HINCGGKQTTIGGIKYEEDEASGGAATFVQATPQNWGFSSTGEFVDPEANGNYTVKLHFAEIVLRDNRSYYGVGRRMFDVYIQDKLVLKDFDIRKEAMGV
  NKEVIKVFNAVVNVKTLLIRFQWAGR
CBM57133414932.3e-26
  HINCGGKPITIGSIKYEGDEASGGAAKFFQDTVNWGFSSTGDYGVMNVDQAYIANNISILKMNNSELYRTARLSFLSLTYYARCLANGNYTVKLHFAEIV
  LRDNRSYYGVGTRFFDVYIQEKLVLKDFNIEKEAQGVDKEVIKVFKAVVNVSTLEIRFYW
CBM577829464.9e-30
  HINCGGKQTTIGGIKYEGDEASGGAATFVQATPPNWGFSSTGDFVDAWSSENDYIANNVSILKMNNSELYKTARLSPLSLTYYAHCLANGNYTVKLHFAE
  IVLRDNRSYYGVGRRMFDVYIQDKLVLKDFDIRKEALGIDKEVIKEFKAVVNVKTLQIRFQWAGR
Full Sequence
Protein Sequence     Length: 1790     Download
MAIGAGLFLP NSGGKTIMNL IVVVMLVISC DNGLVEVEAL TTLLPASEVA ALKEIATQIG    60
KTDWDFSVDP CLNDTTHTSW ATPKSADRPL FNNTLTCNCS FPDGSCHVIN IILRGQDLAG    120
VLPPSIAKLP YLTQIDFTRN FLSGNIPSEW GSTKLEYMSF NVNNLTGPIP AFLGNITTLR    180
YLNLETNMFN GTVPPELGNL VNLQNLILTG QDLDGVLPAS LAKLPYLKQV NLLRNDLSGS    240
IPREWASTKL EYLDLSFNRL EGTIPNFANI MQLSTISGTQ SLTSLFFWVS RQTATVVMLS    300
LGLLFTASFF LRYAHPPPDQ YSLHINCGGK QTTIGGIKYE EDEASGGAAT FVQATPQNWG    360
FSSTGEFVDP EANGNYTVKL HFAEIVLRDN RSYYGVGRRM FDVYIQDKLV LKDFDIRKEA    420
MGVNKEVIKV FNAVVNVKTL LIRFQWAGRG TTNVPRRGIY GSLISAISVQ SDFKPPDDSK    480
RTIYIVVAVV SALCLLFLII GILWLRGCFG HKTTREEELR GLDLQTGYFK FKQIKAATNN    540
FDPANKLGEG GFGAVYKVFT LLTSIVKICG YQGRMAEVLN SQKPVLFSYV AVFVVLICIG    600
PIKSQAQSGT LATEEGKASY FGISVSNVKA LREIAEQLNK KDWNFSDPCS NVPTFSSPHA    660
DQYNNTLVCN CSFSGNICHI QSIYLMGQDL DGVLPASLAK LPYLKQVNLG QNDLNGLIPR    720
EWASTKLEFL VLSVNNLSGP IPGYLGNITT LRALALEGNL FSGPVPSDLG KLINMENQFS    780
LHINCGGKQT TIGGIKYEGD EASGGAATFV QATPPNWGFS STGDFVDAWS SENDYIANNV    840
SILKMNNSEL YKTARLSPLS LTYYAHCLAN GNYTVKLHFA EIVLRDNRSY YGVGRRMFDV    900
YIQDKLVLKD FDIRKEALGI DKEVIKEFKA VVNVKTLQIR FQWAGRGTTN VPRRGKYGSL    960
ISAISVQSDF KPPDDSKTKI YIVVGVVSAL CLIFLIIGIL WFRGCFGHKT TREEELRGMD    1020
LHTGFFRFKQ IKAATDNFNP ANKLGEGGFG AVYKNLLGSD FREVNIGDFG RRRHQGSPTT    1080
NQPLRRVPPC VEMVIFFMVV ICMAQITFEA EAMSLPADEV QALQEIAEQL NKKDWNLSDP    1140
CRNVPTFSIP HADQYYNTLF CNCSFSGNVC HVQTIYLVGQ DLDGVLPPSL VKLPYLKELN    1200
LGQNYLSGTI PPEWGSTKLE FLVLSVNNLS GPIPAFLGNI TTLRSLALES NQFSGNIPPE    1260
LGRLVNMEVL YLRANNLIGQ LPVTLTNMTK LNTLDLSFNR LEGSIPNLDN LIRLATIILC    1320
NCLYPCSKEQ YSLHINCGGK PITIGSIKYE GDEASGGAAK FFQDTVNWGF SSTGDYGVMN    1380
VDQAYIANNI SILKMNNSEL YRTARLSFLS LTYYARCLAN GNYTVKLHFA EIVLRDNRSY    1440
YGVGTRFFDV YIQEKLVLKD FNIEKEAQGV DKEVIKVFKA VVNVSTLEIR FYWAGKGTTN    1500
SPRRGTFGSL ISAISVESDF KPPGDSNRIM FIVIGVALVL CLIFMVFGIL WLRSFFGGKT    1560
SREQELKGLD LQTGLFRFKQ IKAATNNFDA ANKLGEGGFG IVYKVFSDSF LLKGYMAPEY    1620
ALWGYLTDKV DVYSFGVVAL ELVSGKNIKF RSNENYVCLL DWALILQQKE NLMELVDPKL    1680
GSKFNKEQAM RMIKVALLCT NPSPALRPTM SAALSMLEGR AVIHESSRNL SMYGDELGSM    1740
ASRDDSNDLN IQHSPSETRS LIYLSDAKGP EASSSRTIHD NYTFNLESP*               1800
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN00113PLN001136.0e-2511631306150+
PLN00113PLN001136.0e-2695277186+
pfam11721Malectin8.0e-42321467169+
pfam11721Malectin3.0e-5213311514187+
pfam11721Malectin1.0e-52780964188+
Gene Ontology
GO TermDescription
GO:0004672protein kinase activity
GO:0005515protein binding
GO:0005524ATP binding
GO:0006468protein phosphorylation
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ulz_A2e-1715791719158308A Chain A, Raphanus Sativus Anionic Peroxidase.
PDB3uim_A2e-1715791719158308A Chain A, Structural Basis For The Impact Of Phosphorylation On Plant Receptor- Like Kinase Bak1 Activation
Transmembrane Domains
StartEnd
483505
585602
9801002
10891108
15301552
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_039_00020.3Aquca_039_00020.2Aquca_039_00020.1Aquca_039_00021.1Aquca_039_00015.1
Aquca_039_00022.1Aquca_039_00018.1Aquca_039_00016.1Aquca_039_00019.1Aquca_055_00015.1
Aquca_012_00201.2Aquca_012_00201.1Aquca_039_00012.3Aquca_039_00012.2Aquca_039_00012.1
Arabidopsis lyrata474473474471881264473178866958
885138473176470791478899
Arabidopsis thalianaAT1G53440.1AT1G53430.2AT1G53430.1AT1G29720.1AT1G53420.1
AT1G29740.1AT1G07650.2AT1G07650.1AT1G29730.1AT1G29750.2
AT1G29750.1AT3G14840.2
Brachypodium distachyonBradi3g08917.2Bradi3g08917.1Bradi4g28367.1
Brassica rapaBra038124Bra010815Bra032332Bra030168Bra018693
Bra030169Bra027306Bra032331Bra030170Bra001566
Bra027307Bra030167Bra030174Bra027302Bra021579
Bra030161Bra030166Bra001567Bra010817Bra032333
Bra010816
Carica papayaevm.TU.contig_37590.1evm.model.supercontig_77.40evm.model.supercontig_77.35evm.model.supercontig_124.19evm.model.supercontig_124.16
Capsella rubellaCarubv10011641mCarubv10012061mCarubv10012394mCarubv10006720mCarubv10008178m
Carubv10008435mCarubv10011126mCarubv10012882mCarubv10008187mCarubv10011709m
Carubv10008366mCarubv10021813mCarubv10016637mCarubv10011128m
Citrus clementinaCiclev10018721mCiclev10018686mCiclev10024314mCiclev10018908mCiclev10019246m
Ciclev10018771mCiclev10014830mCiclev10014765mCiclev10014427mCiclev10014395m
Ciclev10014258mCiclev10014129mCiclev10014126mCiclev10014125mCiclev10024045m
Ciclev10023853mCiclev10020672mCiclev10020826m
Citrus sinensisorange1.1g004275morange1.1g001768morange1.1g001767morange1.1g043333morange1.1g045177m
orange1.1g040908morange1.1g006906morange1.1g005361morange1.1g003737morange1.1g003134m
orange1.1g002899morange1.1g002566morange1.1g046961morange1.1g023918morange1.1g045835m
orange1.1g040398morange1.1g027337m
Cucumis sativusCucsa.273550.2Cucsa.273550.1Cucsa.057870.1Cucsa.057860.1Cucsa.212760.1
Cucsa.185230.1Cucsa.057940.1Cucsa.057890.1Cucsa.057880.1
Eucalyptus grandisEucgr.F01301.1Eucgr.F01305.3Eucgr.F01305.2Eucgr.F01305.1Eucgr.F01302.1
Eucgr.F01306.1Eucgr.F04179.1Eucgr.F04177.1Eucgr.F04178.1Eucgr.B00978.1
Eucgr.B00894.1Eucgr.B00963.1Eucgr.B00960.1Eucgr.B00972.1Eucgr.F01359.1
Eucgr.K01762.1Eucgr.K01777.2Eucgr.K01777.1Eucgr.K01737.1Eucgr.F01312.2
Eucgr.F01312.1Eucgr.E04067.1Eucgr.F01308.1Eucgr.F04180.1Eucgr.K01781.2
Eucgr.K01781.1Eucgr.G01055.1Eucgr.K01793.1Eucgr.F01310.1Eucgr.F01353.1
Eucgr.A01951.2Eucgr.K01759.1Eucgr.K01987.1Eucgr.K01985.1Eucgr.F01307.1
Eucgr.K02000.1Eucgr.A01951.1Eucgr.F01314.1Eucgr.K01743.1Eucgr.F01361.2
Eucgr.F01361.1Eucgr.F01357.1Eucgr.F01330.1Eucgr.K01724.1Eucgr.K01771.1
Eucgr.F01362.1Eucgr.F01313.1Eucgr.D00419.1Eucgr.D00415.1Eucgr.E02844.1
Eucgr.E02839.1Eucgr.E02843.1Eucgr.E02842.1Eucgr.D00417.2Eucgr.D00417.1
Fragaria vescamrna27319.1-v1.0-hybridmrna27321.1-v1.0-hybridmrna27328.1-v1.0-hybridmrna27326.1-v1.0-hybridmrna19789.1-v1.0-hybrid
mrna27330.1-v1.0-hybridmrna34059.1-v1.0-hybridmrna27329.1-v1.0-hybridmrna24842.1-v1.0-hybrid.782.946mrna24842.1-v1.0-hybrid.782.946
mrna24842.1-v1.0-hybrid.782.946mrna28915.1-v1.0-hybridmrna23790.1-v1.0-hybridmrna24842.1-v1.0-hybrid.324.449mrna24842.1-v1.0-hybrid.324.449
mrna24842.1-v1.0-hybrid.324.449
Glycine maxGlyma12g25460.2Glyma06g31630.2Glyma13g34140.3Glyma13g34140.2Glyma12g36090.1
Glyma12g36161.2Glyma12g36161.1Glyma12g36190.1Glyma13g34090.2Glyma02g45800.1
Glyma12g36170.2Glyma13g34100.1Glyma14g02990.1Glyma13g34066.5Glyma13g34066.4
Glyma13g34066.3Glyma13g34066.2Glyma13g34066.1Glyma01g29330.2Glyma01g29378.2
Glyma01g29378.1Glyma01g29362.2Glyma01g29362.1Glyma13g29640.1Glyma05g29530.2
Gossypium raimondiiGorai.009G363600.1Gorai.002G049000.1Gorai.007G329800.1Gorai.007G330600.1Gorai.007G330300.1
Gorai.007G330700.1Gorai.009G159600.2Gorai.009G159600.1Gorai.007G330500.2Gorai.007G330500.1
Gorai.009G159500.2Gorai.009G159500.1Gorai.009G159400.2Gorai.009G159400.1Gorai.002G048900.2
Gorai.002G048900.1Gorai.002G048600.1Gorai.002G048300.2Gorai.002G048300.1Gorai.006G003800.1
Gorai.010G162700.2Gorai.010G162700.1Gorai.009G159800.6Gorai.002G048800.2Gorai.002G048800.1
Gorai.007G330000.2Gorai.007G330000.1Gorai.010G162800.6Gorai.010G162800.5Gorai.010G162800.4
Gorai.010G162800.3Gorai.010G162800.2Gorai.010G162800.1Gorai.010G163000.1Gorai.009G159800.5
Gorai.009G159800.4Gorai.009G159800.3Gorai.009G159800.2Gorai.009G159800.1
Linum usitatissimumLus10005550Lus10038153Lus10042505Lus10010951Lus10031374
Lus10005418Lus10015239
Malus domesticaMDP0000292097MDP0000263999MDP0000280824MDP0000164991MDP0000314346
MDP0000158644MDP0000196032MDP0000232699MDP0000554411MDP0000204873
MDP0000228140MDP0000195070MDP0000304817MDP0000305229MDP0000197297
MDP0000222736MDP0000228029MDP0000212352MDP0000163412MDP0000207132
MDP0000199384MDP0000845743
Manihot esculentacassava4.1_002090mcassava4.1_000803mcassava4.1_031464mcassava4.1_001160mcassava4.1_001028m
cassava4.1_001039mcassava4.1_000765mcassava4.1_003034mcassava4.1_001048mcassava4.1_000840m
cassava4.1_024552mcassava4.1_025472mcassava4.1_025223mcassava4.1_030745mcassava4.1_004308m
cassava4.1_002534mcassava4.1_031454m
Medicago truncatulaMedtr8g058250.1Medtr2g075250.1Medtr2g075060.1Medtr2g075140.1Medtr2g074980.1
Medtr2g074990.1Medtr2g074840.1Medtr5g083910.1Medtr5g091950.1Medtr2g074880.1
Medtr8g057890.1Medtr8g057900.1Medtr8g087740.1
Mimulus guttatusmgv1a026921mmgv1a000913mmgv1a025582m
Oryza sativaLOC_Os09g17630.1LOC_Os02g13850.1
Panicum virgatumPavirv00034171m
Phaseolus vulgarisPhvul.005G079100.1Phvul.011G167800.1Phvul.005G077900.1Phvul.005G077600.1Phvul.005G077400.1
Phvul.005G078900.1Phvul.005G078500.1Phvul.011G067400.1Phvul.005G078400.1Phvul.008G264400.1
Phvul.005G078100.1Phvul.005G078600.1Phvul.006G170500.2Phvul.006G170500.1Phvul.002G242600.1
Populus trichocarpaPotri.003G025800.1Potri.001G385600.1Potri.001G385900.3Potri.001G385900.2Potri.001G385900.1
Potri.003G026300.1Potri.011G106400.1Potri.001G386300.3Potri.001G386300.2Potri.001G386300.1
Potri.003G025600.1Potri.001G385400.1Potri.001G385300.2Potri.001G385300.1Potri.001G386500.1
Potri.019G009700.1Potri.019G006000.1Potri.019G009500.1Potri.019G009800.2Potri.019G009800.1
Potri.019G005700.1Potri.019G008900.1Potri.019G005900.6Potri.019G005900.5Potri.019G005900.4
Potri.019G005900.3Potri.019G005900.2Potri.019G005900.1Potri.001G385200.3Potri.001G385200.2
Potri.001G385200.1Potri.019G005300.2Potri.019G005300.1Potri.016G061500.4Potri.016G061500.3
Potri.016G061500.2Potri.016G061500.1Potri.019G007900.1Potri.001G384700.1Potri.019G005000.2
Potri.019G005000.1Potri.T033300.1Potri.T010200.1Potri.001G308600.2Potri.001G308600.1
Potri.004G135500.2Potri.004G135500.1Potri.011G075300.1Potri.T008400.1Potri.T032500.4
Potri.T032500.3Potri.T032500.2Potri.T032500.1Potri.T008300.1Potri.011G073700.2
Potri.011G073700.1Potri.019G004800.1Potri.019G004600.1Potri.019G005200.2Potri.019G005200.1
Potri.001G385500.1Potri.T007800.1Potri.T009500.1Potri.T009000.1Potri.T009600.1
Potri.T032700.6Potri.T032700.5Potri.T032700.4Potri.T032700.3Potri.T032700.2
Potri.T032700.1Potri.011G072800.1Potri.T009900.1Potri.T072700.1Potri.011G072300.1
Potri.004G063200.5Potri.004G063200.4Potri.004G063200.3Potri.004G063200.2Potri.004G063200.1
Potri.T032400.2Potri.T032400.1Potri.011G072600.1Potri.011G075400.3Potri.011G075400.2
Potri.011G075400.1Potri.004G063500.1Potri.T009100.1Potri.T033000.1Potri.T032200.2
Potri.T032200.1Potri.T008600.2Potri.T008600.1Potri.004G063500.2Potri.016G012100.1
Potri.016G011200.5Potri.016G011200.4Potri.016G011200.1Potri.016G011400.2Potri.016G011400.1
Potri.010G155600.1Potri.006G014300.1Potri.T008900.1Potri.006G014100.2Potri.006G014100.1
Prunus persicappa000854mppa000741mppa000742mppa001005mppa000698m
ppa001122mppa001161mppa026371mppa017351mppa000939m
ppa000808mppa015564mppa001834mppa003884mppa021182m
Ricinus communis27894.m00077429628.m00076427894.m00077527894.m00077830026.m001493
29618.m00010230026.m001490.397.56830026.m001490.397.56830026.m00149230026.m001491
Setaria italicaSi016192mSi016254mSi016251mSi028799mSi028810m
Sorghum bicolorSb04g008350.1
Thellungiella halophilaThhalv10011204mThhalv10006670mThhalv10007070mThhalv10006761mThhalv10012029m
Thhalv10006680mThhalv10019958m
Vitis viniferaGSVIVT01014147001GSVIVT01014138001GSVIVT01014149001GSVIVT01014145001GSVIVT01014150001
GSVIVT01014134001GSVIVT01021289001GSVIVT01021285001GSVIVT01021291001GSVIVT01014128001
GSVIVT01021286001GSVIVT01014120001GSVIVT01014117001GSVIVT01034309001GSVIVT01014113001
GSVIVT01014110001GSVIVT01020786001GSVIVT01021278001GSVIVT01021297001GSVIVT01021293001
GSVIVT01021282001GSVIVT01000677001GSVIVT01021283001GSVIVT01021280001GSVIVT01001886001
GSVIVT01034320001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)