y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna25266.1-v1.0-hybrid
FamilyAA1
Protein PropertiesLength: 385 Molecular Weight: 42921.8 Isoelectric Point: 9.5419
ChromosomeChromosome/Scaffold: 2 Start: 3788031 End: 3789683
Descriptionlaccase 11
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA1283730
  AAVKSYQFDIQVKNVSRLCHSKPIVTVNGMFPGPTVYAREGDTLLINVTNHAQYNMSIHWHGLKQYRNGWADGPAYITQCPIKTGSSYIYNMTVTGQRGT
  LWWHAHIFWLRATVYGAIVVLPKQGTVFPFPRPYREANLILGEWWNNDVEEVVKQGNRLGLPPNMSDAHTINGKPGPLFPCSEKHTFAMEVEQRKTYLLR
  IINAALNDELFFAIAGHNLTVVEIDAVYTKPFTSQAILIAPGQTTNVLVQANQVPSRYFMAARPFMNAPVSIDNKTATAILQYKGIPNSVLPVLSQLPAL
  NDTAFALSYAAKLRSLNTPKYPANVPLKVDRQLFYTIGLGINQCTT
Full Sequence
Protein Sequence     Length: 385     Download
MAKTNNFGFC SLLPYLCFVA FLFIPAKAAV KSYQFDIQVK NVSRLCHSKP IVTVNGMFPG    60
PTVYAREGDT LLINVTNHAQ YNMSIHWHGL KQYRNGWADG PAYITQCPIK TGSSYIYNMT    120
VTGQRGTLWW HAHIFWLRAT VYGAIVVLPK QGTVFPFPRP YREANLILGE WWNNDVEEVV    180
KQGNRLGLPP NMSDAHTING KPGPLFPCSE KHTFAMEVEQ RKTYLLRIIN AALNDELFFA    240
IAGHNLTVVE IDAVYTKPFT SQAILIAPGQ TTNVLVQANQ VPSRYFMAAR PFMNAPVSID    300
NKTATAILQY KGIPNSVLPV LSQLPALNDT AFALSYAAKL RSLNTPKYPA NVPLKVDRQL    360
FYTIGLGINQ CTTCLNGMLE IKWT*                                          420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00394Cu-oxidase2.0e-43166312151+
PLN02604PLN026049.0e-4512341362+
TIGR03388ascorbase2.0e-5330361367+
pfam07732Cu-oxidase_37.0e-5436152119+
TIGR03389laccase028377354+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3v9c_A4e-394232315293B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB3fpx_A4e-394232315293A Chain A, Native Fungus Laccase From Trametes Hirsuta
PDB3pxl_A4e-394232315293A Chain A, Type-2 Cu-Depleted Fungus Laccase From Trametes Hirsuta
PDB1asq_B1e-38283611348A Chain A, Type-2 Cu-Depleted Fungus Laccase From Trametes Hirsuta
PDB1asq_A1e-38283611348A Chain A, Type-2 Cu-Depleted Fungus Laccase From Trametes Hirsuta
Transmembrane Domains
StartEnd
726
Signal Peptide
Cleavage Site
28
Hydropathy
Orthologous Group
SpeciesID
Brassica rapaBra005140.25.269Bra005140.25.269Bra005698.25.285Bra005698.25.285
Carica papayaevm.model.supercontig_139.15.34.255evm.model.supercontig_139.15.34.255evm.model.supercontig_169.17.31.279evm.model.supercontig_169.17.31.279evm.model.supercontig_19.219
Citrus sinensisorange1.1g008592m.37.264orange1.1g008592m.37.264
Glycine maxGlyma08g47410.2
Gossypium raimondiiGorai.013G036000.1Gorai.009G103600.1.32.259Gorai.009G103600.1.32.259
Malus domesticaMDP0000192322.23.258MDP0000126274.23.271MDP0000126274.23.271MDP0000192322.23.258MDP0000226556.23.258
MDP0000226556.23.258
Panicum virgatumPavirv00001051mPavirv00052717mPavirv00016758mPavirv00052149m
Phaseolus vulgarisPhvul.008G100600.1.29.296Phvul.008G100600.1.29.296
Picea abiesMA_11289g0010MA_785232g0010MA_10433581g0010MA_21316g0010.22.258MA_21316g0010.22.258
MA_110005g0010
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny