y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna25505.1-v1.0-hybrid
FamilyGH10
Protein PropertiesLength: 1583 Molecular Weight: 177770 Isoelectric Point: 6.2141
ChromosomeChromosome/Scaffold: Start: 6189088 End: 6199945
DescriptionGlycosyl hydrolase family 10 protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH107139760
  KGGSFPFGCAMDKLILSNTAYQNWFTSRFRLTTFENEMKWYSTETSEGHQDYSVPDAMLRFAKQHNIAVRGHNVFWDDPQHQQGWLKSLPTKRLATDAYW
  RARNIVKRYKGQLIAWDVVNENLHFNFFESRMGPLASGIMYNWALKADGATPLFLNEYNTIEDSRDWKASPKAYINRLRGIQRVLDNYKGRFGIGLESHF
  VTPNIPYIRASIDYLATAKVPIWITELDVQSGPNQALYLEQILRELHSHPQVQGIVIWSAWQPQ
GH10123014900
  TRSDFPFGCGMNHNILTSTEYQNWFASRFRYTTFTNEMKWYSTEIKQGQENYTIADGMVKFAKENGISIRGHNVFWDNPKMQPRWVNSTLSPEELGTASA
  KRINSVVARYKGQLIAWDVMNENLHFRFFEDKLGENASAAFYYTAQQLDPGTMMFMNEYNTMEYSSDEASSPANYKKKLEEILSYPGNPNLTAGIGLQGH
  FGSGQPNLAYMRSVLDFLGATGYPIWLTEVSVGIGPNQAQYLEEVLREAYSHPAVQGIIMF
GH102264840
  PSFPFGCAITSLILNNPIHQKWFTSRFTVTTFGDEMKWYSTESIQGREDYSVADAMLQFAQQNNIAVRGHNVFWDDSQYQLGWVKSLDTHQLVNATYKRL
  NSIMQRYKSKLIAWDVVNENLHWNFFESKMGPNASAIFYNWAIKADGETPLFLNDFNTIEESRDGASTPAMYLRKLREIQSFPGNSGGGFGIGLESHFSS
  STPNLPYIRASIDTLGAANVPIWITELDVASHLDQPYYLEQLLRELHSHPRIQGIIMWA
Full Sequence
Protein Sequence     Length: 1583     Download
MKIDGKYSLL LLCTFIFAGS DVKALPYDYS ACIECLANPL KPQYGGGIIT NPEVNDGLKG    60
WSTFGNAELQ HTESQGKKFL VAHSRMQPHD SMSQKVYLQS DKLYTFSAWI QINTGSDVPV    120
AAIFKTASGF KRAGEIIAES NCWSMLKGGL TVEASGTAEL YFESNNTSVE IWVDSISLQP    180
FTEKQWKSHQ DQSIAKNRKS RVRIQAVDAK GEPLPNATVS IQQNVPSFPF GCAITSLILN    240
NPIHQKWFTS RFTVTTFGDE MKWYSTESIQ GREDYSVADA MLQFAQQNNI AVRGHNVFWD    300
DSQYQLGWVK SLDTHQLVNA TYKRLNSIMQ RYKSKLIAWD VVNENLHWNF FESKMGPNAS    360
AIFYNWAIKA DGETPLFLND FNTIEESRDG ASTPAMYLRK LREIQSFPGN SGGGFGIGLE    420
SHFSSSTPNL PYIRASIDTL GAANVPIWIT ELDVASHLDQ PYYLEQLLRE LHSHPRIQGI    480
IMWAGRGHQG CYRMCLTDEN FNNLPTGDVV DKLLQEWGYR SSSSFIADVN GFFEASLPHG    540
DYDMMISQSS TMDFSRCLAN PLKPQYGGGI IVNPELNEGL KGWSTFGNAT MEHRKSENNS    600
FIVAHSRNQP HDSIFQNVHL EIDKLYTFSA WVQVSNGSDV PVTAVFNTPT GFVHAGVTIA    660
ESNCWTMLKG GLTVNASGPA ELYFEIRKSK VKIQAVDAQG NPLPNATISI EQKGGSFPFG    720
CAMDKLILSN TAYQNWFTSR FRLTTFENEM KWYSTETSEG HQDYSVPDAM LRFAKQHNIA    780
VRGHNVFWDD PQHQQGWLKS LPTKRLATDA YWRARNIVKR YKGQLIAWDV VNENLHFNFF    840
ESRMGPLASG IMYNWALKAD GATPLFLNEY NTIEDSRDWK ASPKAYINRL RGIQRVLDNY    900
KGRFGIGLES HFVTPNIPYI RASIDYLATA KVPIWITELD VQSGPNQALY LEQILRELHS    960
HPQVQGIVIW SAWQPQGCYR MCLTDNNFKN LATGNVVDKL LHEWGLRSFE STSAATDANG    1020
FFEASLFHGD YEVTITHPSC LKEPQEALYG GGIIMNPDFN HNMEGWKAFG QGNIEERISK    1080
DGNRFLVAHS RKNASDSFSQ KVQVDQGKIY TFSASVQVSE GSEVVAVVFK FPTGKNIRGG    1140
DMIAEHGCWS LLKGGIVANF TSLVEIHFES KNTSVEIWVD NVSLQPFTKE EWKSHQDKSI    1200
IEQRKSKVRL QVTRANKAPL TGAEVLIKQT RSDFPFGCGM NHNILTSTEY QNWFASRFRY    1260
TTFTNEMKWY STEIKQGQEN YTIADGMVKF AKENGISIRG HNVFWDNPKM QPRWVNSTLS    1320
PEELGTASAK RINSVVARYK GQLIAWDVMN ENLHFRFFED KLGENASAAF YYTAQQLDPG    1380
TMMFMNEYNT MEYSSDEASS PANYKKKLEE ILSYPGNPNL TAGIGLQGHF GSGQPNLAYM    1440
RSVLDFLGAT GYPIWLTEVS VGIGPNQAQY LEEVLREAYS HPAVQGIIMF VGPITAGFNE    1500
TTLVDKNFNN TPSGDVVDKL IAEWKTGSLE LATDDQGYID VSLFHGDYEV TAEDNFASSS    1560
ATLSFKVTKD EPQSIVQVQI DT*                                            1620
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00331Glyco_hydro_101.0e-4612321517309+
pfam00331Glyco_hydro_102.0e-47715970283+
smart00633Glyco_107.0e-64750997279+
smart00633Glyco_103.0e-66261510272+
smart00633Glyco_105.0e-6812671517273+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1i1x_A5e-25122615179297A Chain A, Insight Into The Mechanism Of Enzymatic Glycosyltransfer With Retention Through The Synthesis And Analysis Of Bisubstrate Glycomimetics Of Trehalose-6-Phosphate Synthase
PDB1i1x_A7e-2023051618303A Chain A, Insight Into The Mechanism Of Enzymatic Glycosyltransfer With Retention Through The Synthesis And Analysis Of Bisubstrate Glycomimetics Of Trehalose-6-Phosphate Synthase
PDB1i1x_A4e-1971598814288A Chain A, Insight Into The Mechanism Of Enzymatic Glycosyltransfer With Retention Through The Synthesis And Analysis Of Bisubstrate Glycomimetics Of Trehalose-6-Phosphate Synthase
PDB1i1w_A5e-25122615179297A Chain A, 0.89a Ultra High Resolution Structure Of A Thermostable Xylanase From Thermoascus Aurantiacus
PDB1i1w_A7e-2023051618303A Chain A, 0.89a Ultra High Resolution Structure Of A Thermostable Xylanase From Thermoascus Aurantiacus
Signal Peptide
Cleavage Site
24
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00095.4.344.628Aquca_017_00095.3.344.628Aquca_017_00095.2.564.848Aquca_017_00095.1.577.861Aquca_006_00211.1
Aquca_003_00413.1Aquca_011_00218.1.200.461Aquca_011_00219.1.223.486Aquca_006_00211.2
Arabidopsis lyrata475392.571.844489729.403.684490628913024.223.481491296
491295.221.480353449353450480358
Arabidopsis thalianaAT1G58370.1.570.844AT4G08160.1.404.685AT4G08160.2.404.657AT4G38650.1AT4G38300.1
AT4G33830.1.222.485AT4G33840.1.222.480AT4G33860.1.222.480AT4G33820.1AT4G33810.1
AT2G14690.1
Brachypodium distachyonBradi1g12710.1.410.670Bradi2g02320.1.243.531Bradi2g02330.1Bradi1g27257.1.195.481Bradi5g04640.1
Bradi1g68310.1Bradi3g24410.1Bradi1g71040.1.232.494Bradi1g71076.1Bradi1g71050.1
Brassica rapaBra031698.712.996Bra027867.572.849Bra039768.635.918Bra010733Bra017609.315.575
Bra034585.221.481Bra034584.220.481Bra034586Bra036392Bra017610
Carica papayaevm.model.supercontig_160.18.423.706evm.model.supercontig_160.19.570.841evm.model.supercontig_37.165evm.model.supercontig_106.45.230.491evm.model.supercontig_169.45
evm.model.supercontig_106.44
Capsella rubellaCarubv10008217m.613.898Carubv10019737m.593.868Carubv10000293m.404.688Carubv10004489mCarubv10004963m
Carubv10006586m.221.480Carubv10006745mCarubv10004408mCarubv10015996m
Citrus clementinaCiclev10000171m.611.880Ciclev10030219mCiclev10028121mCiclev10030382m.227.489Ciclev10028089m
Citrus sinensisorange1.1g002447m.574.843orange1.1g036715morange1.1g035723morange1.1g042396morange1.1g008838m
Cucumis sativusCucsa.353160.7.566.835Cucsa.353160.4.599.868Cucsa.353160.1.599.868Cucsa.353160.8.341.611Cucsa.143690.1.601.869
Cucsa.169000.1Cucsa.219120.1Cucsa.298380.1
Eucalyptus grandisEucgr.F00109.1.537.816Eucgr.F00108.3.544.819Eucgr.F00108.2.583.858Eucgr.F00108.1.587.862Eucgr.F02205.1.452.713
Eucgr.I01059.1Eucgr.G01773.1Eucgr.I01060.1Eucgr.I01061.1Eucgr.G01210.1
Eucgr.G01205.1Eucgr.G01215.1Eucgr.G01214.1Eucgr.G01217.1Eucgr.G01206.1
Eucgr.G01213.1Eucgr.G01209.1
Fragaria vescamrna02649.1-v1.0-hybrid.593.860mrna07626.1-v1.0-hybridmrna25505.1-v1.0-hybrid.713.976mrna25505.1-v1.0-hybrid.713.976mrna25505.1-v1.0-hybrid.713.976
mrna28152.1-v1.0-hybrid.228.491mrna25508.1-v1.0-hybrid.175.436mrna25505.1-v1.0-hybrid.226.484mrna25505.1-v1.0-hybrid.226.484mrna25505.1-v1.0-hybrid.226.484
Glycine maxGlyma14g10456.2.555.825Glyma14g10456.1.584.854Glyma06g05290.1.396.666Glyma04g05220.3.395.665Glyma04g05220.2.395.665
Glyma17g35060.2.585.853Glyma17g35060.1.556.824Glyma06g00680.1Glyma04g00610.2Glyma04g00610.1
Glyma11g11220.1.211.472Glyma11g11200.1.222.493Glyma20g27040.1Glyma10g40300.2Glyma10g40300.1
Glyma10g40293.1
Gossypium raimondiiGorai.009G223500.6.425.707Gorai.009G223500.5.565.847Gorai.009G223500.4.564.846Gorai.009G223500.3.565.847Gorai.009G223500.2.564.846
Gorai.009G223500.1.565.847Gorai.009G223600.1.421.696Gorai.010G029100.1.585.855Gorai.005G231200.1Gorai.008G020100.2
Gorai.008G020100.1Gorai.005G231100.2Gorai.005G231100.1Gorai.002G195600.1.359.528Gorai.002G195600.1.359.528
Gorai.002G195600.1.359.528Gorai.002G195600.1.168.257Gorai.002G195600.1.168.257Gorai.002G195600.1.168.257Gorai.002G195600.1.280.355
Gorai.002G195600.1.280.355Gorai.002G195600.1.280.355
Linum usitatissimumLus10007242.429.712Lus10028242.428.711Lus10025054Lus10033786.213.477Lus10014642.218.482
Lus10020985.202.471Lus10033784Lus10034490Lus10014646
Malus domesticaMDP0000225641.598.870MDP0000246856MDP0000249571MDP0000245498.229.493MDP0000144523
MDP0000779011MDP0000146624.768.905MDP0000146624.768.905MDP0000132261MDP0000146624.669.763
MDP0000146624.669.763
Manihot esculentacassava4.1_002200m.411.692cassava4.1_001250m.571.847cassava4.1_001252m.573.850cassava4.1_001320m.557.841cassava4.1_033386m
cassava4.1_029937mcassava4.1_021918m.217.482cassava4.1_021990mcassava4.1_028847mcassava4.1_026436m
Medicago truncatulaMedtr3g117800.1Medtr7g024420.1Medtr1g106800.1Medtr1g106790.1Medtr1g106910.1
Medtr1g106770.1
Mimulus guttatusmgv1a027071m.549.820mgv1a000981m.578.858mgv1a020606mmgv1a003597m.225.485mgv1a023132m
mgv1a024427mmgv1a003542mmgv1a019481mmgv1a025021mmgv1a022322m
mgv1a004157mmgv1a004760mmgv1a021702mmgv1a004887m
Oryza sativaLOC_Os03g47010.1.411.694LOC_Os01g04300.1.211.499LOC_Os01g04290.1LOC_Os05g25560.1LOC_Os05g23350.1
LOC_Os03g14010.3LOC_Os03g14010.2LOC_Os03g14010.1LOC_Os05g23924.2LOC_Os05g23924.1
LOC_Os03g10469.2LOC_Os03g10469.1LOC_Os10g21110.1LOC_Os03g10440.1.227.490LOC_Os03g10478.1.232.497
LOC_Os10g21100.1
Panicum virgatumPavirv00018091m.408.690Pavirv00043679m.401.686Pavirv00043214mPavirv00009472m.233.513Pavirv00011920m
Pavirv00064836mPavirv00011543mPavirv00004670mPavirv00012621mPavirv00003316m
Pavirv00046655mPavirv00001379mPavirv00041480mPavirv00066390mPavirv00041724m
Pavirv00066756mPavirv00064807mPavirv00011965mPavirv00070694m.721.846Pavirv00049463m
Pavirv00011967mPavirv00011966mPavirv00027101m.191.313Pavirv00026745m.214.317
Physcomitrella patensPp1s121_107V6.1.717.999
Phaseolus vulgarisPhvul.009G075400.1.397.677Phvul.001G032300.2.556.827Phvul.001G032300.1.583.854Phvul.009G120500.1Phvul.011G033100.1.217.499
Phvul.007G045400.1Phvul.007G045500.1Phvul.007G045900.1
Picea abiesMA_9039435g0010.206.470MA_350255g0010MA_604666g0010MA_10433351g0010MA_9354042g0010
MA_429144g0010.244.407MA_8357324g0010
Populus trichocarpaPotri.002G113100.2.412.693Potri.004G173300.4Potri.004G173300.3Potri.004G173300.2Potri.004G173300.1
Potri.009G087900.1.202.466Potri.009G087800.3Potri.009G087800.2Potri.009G087800.1Potri.009G087700.2
Potri.009G087700.1Potri.009G087600.1
Prunus persicappa001089m.567.845ppa004290mppa016947mppa021363m.219.483ppa023031m
ppa024827m
Ricinus communis30170.m013644.481.75830170.m01364629492.m00007029812.m00019629812.m000195.218.483
29812.m00019429812.m00019958888.m000026
Setaria italicaSi038956m.406.689Si000821mSi000630m.297.586Si025026mSi034995m.207.495
Si001255mSi034968mSi039948mSi034867m.230.491Si039549m
Si039641mSi034912m.223.486
Selaginella moellendorffii111304.535.794420481.257.518
Sorghum bicolorSb01g012210.1.405.688Sb03g006980.1.246.530Sb03g006950.1.218.506Sb04g020543.1Sb01g041310.1
Sb06g003350.1Sb01g043760.1Sb02g004490.1Sb01g043730.1Sb01g043720.1
Thellungiella halophilaThhalv10023244m.581.848Thhalv10028466m.388.667Thhalv10024805mThhalv10027468m.221.481Thhalv10024995m.219.458
Thhalv10023172m
Vitis viniferaGSVIVT01009272001.602.834GSVIVT01024049001GSVIVT01037833001.244.520GSVIVT01037833001.244.520GSVIVT01037832001
GSVIVT01037825001.197.461
Volvox carteriVocar20000377mVocar20006952m
Zea maysAC204711.3_FGT002
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)