y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna25508.1-v1.0-hybrid
FamilyCBM22
Protein PropertiesLength: 527 Molecular Weight: 59216.4 Isoelectric Point: 6.6323
ChromosomeChromosome/Scaffold: Start: 6219291 End: 6221278
DescriptionGlycosyl hydrolase family 10 protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM2221157.8e-22
  NPEFNNGLKGWSSFGNAKLEHKESQGNKFLVALSRSQPHDSMSQKVYLQADKLYTFSAWIQASSGSGIPIAAMFKTASGFLSAGQVIAESSCWSMLKGGL
  TVEASGDAELYFES
GH101754360
  KYPSFPFGCSMTKLILNNPAHQKWFTSRFRVTTFGDEMKWYSTEYVQGHEDYSVADAMLQFAQQNNIAVRGHNVLWDDPQYQLGWVKSLDAQQLESATNK
  RLNSVMQRYKGKVIAWDVVNENLHFNFFESKMGPNASAIFYNWATKADGGTPLFLNDFNTIEESRDELSSPAKYLQKLREIQSFPGNEGGRYGIGLESHF
  DSSIPNIPYIRASLDTLAAAKVPIWITELDVSSHLDQPLYLEQLLRELHSHPQIQGIVIWGG
Full Sequence
Protein Sequence     Length: 527     Download
MNPEFNNGLK GWSSFGNAKL EHKESQGNKF LVALSRSQPH DSMSQKVYLQ ADKLYTFSAW    60
IQASSGSGIP IAAMFKTASG FLSAGQVIAE SSCWSMLKGG LTVEASGDAE LYFESKNTSV    120
EIWVDSISLQ PFTKNQWKSH QDQSIAMNRK RKVRIQAVDA RGSPLPNATI SIQQKYPSFP    180
FGCSMTKLIL NNPAHQKWFT SRFRVTTFGD EMKWYSTEYV QGHEDYSVAD AMLQFAQQNN    240
IAVRGHNVLW DDPQYQLGWV KSLDAQQLES ATNKRLNSVM QRYKGKVIAW DVVNENLHFN    300
FFESKMGPNA SAIFYNWATK ADGGTPLFLN DFNTIEESRD ELSSPAKYLQ KLREIQSFPG    360
NEGGRYGIGL ESHFDSSIPN IPYIRASLDT LAAAKVPIWI TELDVSSHLD QPLYLEQLLR    420
ELHSHPQIQG IVIWGGRGPQ GCYRMCLTDE NFNNLPTGDV VDKLLREWGY WTSDSDSFTT    480
DNNGYFEASL PHGDYDVKIS HYSAVDSSRV HKLNVASTTR SLQLIV*                  540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02018CBM_4_98.0e-61119129+
COG3693XynA3.0e-33211456276+
pfam00331Glyco_hydro_101.0e-51171435286+
smart00633Glyco_103.0e-78212461272+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0016798hydrolase activity, acting on glycosyl bonds
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ta3_B7e-2618143517269B Chain B, Crystal Structure Of Xylanase (Gh10) In Complex With Inhibitor (Xip)
PDB1tux_A9e-2518146518301A Chain A, High Resolution Crystal Structure Of A Thermostable Xylanase From Thermoascus Aurantiacus
PDB1nq6_A1e-2318143515269A Chain A, Crystal Structure Of The Catalytic Domain Of Xylanase A From Streptomyces Halstedii Jm8
PDB2bnj_A4e-2218146718303A Chain A, The Xylanase Ta From Thermoascus Aurantiacus Utilizes Arabinose Decorations Of Xylan As Significant Substrate Specificity Determinants
PDB1i1x_A1e-2118146718303A Chain A, The Xylanase Ta From Thermoascus Aurantiacus Utilizes Arabinose Decorations Of Xylan As Significant Substrate Specificity Determinants
Hydropathy