y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna25836.1-v1.0-hybrid
FamilyAA2
Protein PropertiesLength: 271 Molecular Weight: 30112.2 Isoelectric Point: 5.0103
ChromosomeChromosome/Scaffold: 6 Start: 25801814 End: 25803099
DescriptionPeroxidase family protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2152516.8e-31
  PTTSAALLRLAFHDCQVDGCDASVLLREADGSSSMETESDKNFGIRKLETIDMIKTSLEQHCPQTVSCADIIQLAAREAIYLTLTPEAGNSKELIYNQLP
  LASISIDDCIQIFRQKNISLEQGVARAHTLGITHCRNINERLRPASDPTLSLTYSLPLQTICSNALLSDTTFSANDATPVTFDNHYFNDIENGRGLLKID
  SEIARDPRTMPFVIQYGRDMKLFFDTFSSAFLKHSSL
Full Sequence
Protein Sequence     Length: 271     Download
MIVKELMKPI ILTDPTTSAA LLRLAFHDCQ VDGCDASVLL READGSSSME TESDKNFGIR    60
KLETIDMIKT SLEQHCPQTV SCADIIQLAA REAIYLTLTP EAGNSKELIY NQLPLASISI    120
DDCIQIFRQK NISLEQGVAR AHTLGITHCR NINERLRPAS DPTLSLTYSL PLQTICSNAL    180
LSDTTFSAND ATPVTFDNHY FNDIENGRGL LKIDSEIARD PRTMPFVIQY GRDMKLFFDT    240
FSSAFLKHSS LNVLVGEDGE VRRDCKYRNS *                                   300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00691ascorbate_peroxidase6.0e-821253264+
cd00314plant_peroxidase_like1.0e-1719247266+
pfam00141peroxidase4.0e-343233241+
PLN03030PLN030304.0e-392269289+
cd00693secretory_peroxidase4.0e-922265283+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1gx2_B1e-38227018307A Chain A, Recombinant Horseradish Peroxidase Phe209ser Complex With Benzhydroxamic Acid
PDB1gx2_A1e-38227018307A Chain A, Recombinant Horseradish Peroxidase Phe209ser Complex With Benzhydroxamic Acid
PDB3atj_B3e-38227018307A Chain A, Heme Ligand Mutant Of Recombinant Horseradish Peroxidase In Complex With Benzhydroxamic Acid
PDB3atj_A3e-38227018307A Chain A, Heme Ligand Mutant Of Recombinant Horseradish Peroxidase In Complex With Benzhydroxamic Acid
PDB1gwt_A3e-38227018307A Chain A, Heme Ligand Mutant Of Recombinant Horseradish Peroxidase In Complex With Benzhydroxamic Acid
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_001_00478.1Aquca_005_00071.2Aquca_005_00071.1Aquca_016_00057.1Aquca_005_00071.3
Arabidopsis lyrata898035492673345443
Arabidopsis thalianaAT3G17070.1AT2G37130.2AT2G37130.1AT4G21960.1
Brassica rapaBra022195Bra017206Bra023099Bra013576
Carica papayaevm.model.supercontig_152.14evm.model.supercontig_525.1
Capsella rubellaCarubv10014103mCarubv10023623mCarubv10005223m
Citrus clementinaCiclev10026124mCiclev10026035mCiclev10012170mCiclev10015870mCiclev10016494m
Citrus sinensisorange1.1g045164morange1.1g020143morange1.1g020084morange1.1g021519morange1.1g019854m
orange1.1g019129morange1.1g021841morange1.1g026488morange1.1g020712morange1.1g021207m
orange1.1g028028morange1.1g036121m
Cucumis sativusCucsa.307020.2Cucsa.307020.1Cucsa.085830.1Cucsa.124250.1Cucsa.307020.3
Eucalyptus grandisEucgr.E03999.1Eucgr.E04056.1Eucgr.D01322.1Eucgr.A01166.1
Fragaria vescamrna05105.1-v1.0-hybridmrna19619.1-v1.0-hybridmrna09649.1-v1.0-hybrid
Glycine maxGlyma07g39290.1Glyma17g01440.2Glyma13g20170.1Glyma10g05800.1Glyma17g01720.1
Glyma07g39020.1Glyma04g10761.1
Gossypium raimondiiGorai.011G200600.1Gorai.006G168000.3Gorai.006G168000.1Gorai.009G419100.1Gorai.006G168000.2
Gorai.009G178400.1
Linum usitatissimumLus10015074Lus10006778Lus10020045
Malus domesticaMDP0000292744MDP0000124622MDP0000303101MDP0000545323MDP0000192235
Manihot esculentacassava4.1_011604mcassava4.1_012064mcassava4.1_031903m
Medicago truncatulaMedtr6g045330.1Medtr4g132490.1Medtr4g132110.2Medtr1g066380.1Medtr4g132110.1
Medtr1g066380.2Medtr4g132110.3
Mimulus guttatusmgv1a009704mmgv1a009981mmgv1a010406mmgv1a007622mmgv1a010067m
mgv1a019681mmgv1a025816mmgv1a026804m
Oryza sativaLOC_Os07g49360.1LOC_Os05g14260.1
Panicum virgatumPavirv00050429mPavirv00010935m
Physcomitrella patensPp1s8_186V6.1Pp1s44_71V6.1Pp1s10_225V6.1Pp1s62_126V6.1Pp1s16_148V6.1
Pp1s104_177V6.3Pp1s104_177V6.2Pp1s104_177V6.1Pp1s433_15V6.2Pp1s433_15V6.1
Phaseolus vulgarisPhvul.007G107400.1Phvul.003G078600.1
Picea abiesMA_83406g0010MA_530154g0010MA_10432809g0020MA_10427936g0010MA_6481365g0010
MA_10432809g0010
Populus trichocarpaPotri.004G015300.2Potri.004G015300.1Potri.006G129900.1Potri.004G006400.1
Prunus persicappa008634mppa022386mppa008503m
Ricinus communis29842.m00359530078.m002355
Setaria italicaSi022597m
Selaginella moellendorffii10502977725116945140930107369
1370671793877725976459403456
11598223276377662
Sorghum bicolorSb09g007950.1Sb09g018150.1
Thellungiella halophilaThhalv10021081mThhalv10016921mThhalv10025680m
Vitis viniferaGSVIVT01034984001GSVIVT01025650001GSVIVT01012727001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)