y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna25929.1-v1.0-hybrid
FamilyGH1
Protein PropertiesLength: 358 Molecular Weight: 39002.9 Isoelectric Point: 4.8837
ChromosomeChromosome/Scaffold: 6 Start: 38503410 End: 38505202
Descriptionbeta glucosidase 32
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1973040
  RADFPADFKFGCATSAFQTEGSGTEGGRGPATWDSYIQDATVDGTEIAVDSYNRYKDDVQLLKNMGVDTYRFSMSWSRLLPDGTIDGGINQEGIDFYNNF
  IDELIANGITPFVTLFHFDLPTALNTKYNGFLSIDIVEDFKAYADLCFKTFGDRVKYWATINEPQVWGQYGFTNTAADANAATDPYVSSHNVILAHATAA
  KLYKNTYQ
Full Sequence
Protein Sequence     Length: 358     Download
MALPLSFSLP TLAPRAPLSS FKRLPSRIPT VKALGVFPSK GIDHKRAIRI RPCSALGDLT    60
SSLTSAVTTT VAVAADTAAT VVDTTTTTTT ETAEVTRADF PADFKFGCAT SAFQTEGSGT    120
EGGRGPATWD SYIQDATVDG TEIAVDSYNR YKDDVQLLKN MGVDTYRFSM SWSRLLPDGT    180
IDGGINQEGI DFYNNFIDEL IANGITPFVT LFHFDLPTAL NTKYNGFLSI DIVEDFKAYA    240
DLCFKTFGDR VKYWATINEP QVWGQYGFTN TAADANAATD PYVSSHNVIL AHATAAKLYK    300
NTYQGYLMWA LMDCVEMGSG YAVRFGLNYT DYLNDLVRTP KKSAAWLKDF LASTTST*      360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00232Glyco_hydro_15.0e-1130435451+
COG2723BglB1.0e-1130335351+
TIGR03356BGL3.0e-70101300206+
COG2723BglB2.0e-77100300209+
pfam00232Glyco_hydro_11.0e-82100300207+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2jf7_B0643044261A Chain A, Structure Of The Yici Thiosugar Michaelis Complex
PDB2jf7_B0.00001304357460512A Chain A, Structure Of The Yici Thiosugar Michaelis Complex
PDB2jf7_A0643044261A Chain A, Structure Of The Yici Thiosugar Michaelis Complex
PDB2jf7_A0.00001304357460512A Chain A, Structure Of The Yici Thiosugar Michaelis Complex
PDB2jf6_B0643044261A Chain A, Structure Of Inactive Mutant Of Strictosidine Glucosidase In Complex With Strictosidine
Hydropathy
Orthologous Group
SpeciesID
Fragaria vescamrna25930.1-v1.0-hybridmrna26383.1-v1.0-hybrid
Glycine maxGlyma08g46181.1
Malus domesticaMDP0000124415
Medicago truncatulaMedtr7g051510.1Medtr7g051650.2Medtr7g051610.1Medtr7g051650.1Medtr7g051610.2
Medtr7g051650.3Medtr7g051610.3
Phaseolus vulgarisPhvul.008G136500.1
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny