y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna26037.1-v1.0-hybrid
FamilyCE8
Protein PropertiesLength: 543 Molecular Weight: 59760.2 Isoelectric Point: 5.2273
ChromosomeChromosome/Scaffold: 5 Start: 7209409 End: 7211037
DescriptionPlant invertase/pectin methylesterase inhibitor superfamily
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE82295350
  VTVCKDDKTDCYRTIQAAVDAAPENSNEFFVIKINAGVYEEIVGIPLEKRNVVFLGEGMGKTVITGSLYVGLPGIGTYNSATVAVYGDGFMASGVTFENK
  AGPDAKQEVHQAVAFRSDSDRSIIEDCEFLGHQDTLYARSNRQLYKSCRIQGNVDFIFGNAAAMFDNCTILIESREVTPEKGEKNAVTAHGRTDPAQATG
  FVFRNCFINGTEEYMKLYKKDPKVHLNYLGRPWKEFSRTVFLNCSMEGLVSKEGWMPWSDQFALATLYYGEYGNSGPGADLAGRVKWSSEIPAEHVDAYS
  VQNFVQG
Full Sequence
Protein Sequence     Length: 543     Download
MASRFFLLTL TLTLSLTLSS ATRFLSDSKL AASSPIDQAC KATRFPDTCK ASLSNKTHDL    60
PSDPSPLQTL QLALNVSFNG LKTAQNMVAD ILNSAAGSVN RTTGAKNCII NLQNSEYRIL    120
LSQDALKNGR TKTARAAMSS ALIYQFDCWY AFKYANDTQL VISTMSFIND SLTVDTSNAL    180
SMIFSYENFG NDTKSWSPPK TERDGLWQVT LSNNSSSDYS VPKDLTVNVT VCKDDKTDCY    240
RTIQAAVDAA PENSNEFFVI KINAGVYEEI VGIPLEKRNV VFLGEGMGKT VITGSLYVGL    300
PGIGTYNSAT VAVYGDGFMA SGVTFENKAG PDAKQEVHQA VAFRSDSDRS IIEDCEFLGH    360
QDTLYARSNR QLYKSCRIQG NVDFIFGNAA AMFDNCTILI ESREVTPEKG EKNAVTAHGR    420
TDPAQATGFV FRNCFINGTE EYMKLYKKDP KVHLNYLGRP WKEFSRTVFL NCSMEGLVSK    480
EGWMPWSDQF ALATLYYGEY GNSGPGADLA GRVKWSSEIP AEHVDAYSVQ NFVQGDEWLV    540
YN*                                                                  600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02713PLN027132.0e-97229539320+
PLN02745PLN027452.0e-9836539528+
PLN02301PLN023018.0e-10040539509+
pfam01095Pectinesterase3.0e-144228536312+
PLN02708PLN02708031539517+
Gene Ontology
GO TermDescription
GO:0004857enzyme inhibitor activity
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1gq8_A02285398308A Chain A, Pectin Methylesterase From Carrot
PDB1xg2_A02255391304B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB3uw0_A7e-2122851832347A Chain A, Pectin Methylesterase From Yersinia Enterocolitica
PDB2ntq_B3e-192264833279A Chain A, Pectin Methylesterase From Yersinia Enterocolitica
PDB2ntq_A3e-192264833279A Chain A, Pectin Methylesterase From Yersinia Enterocolitica
Signal Peptide
Cleavage Site
21
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_1260_00001.1Aquca_022_00312.1
Arabidopsis lyrata919784325521
Arabidopsis thalianaAT5G09760.1AT5G64640.1
Brachypodium distachyonBradi2g56820.1Bradi5g10700.1
Brassica rapaBra024317Bra028619Bra037786Bra006031Bra009401
Bra028617Bra009400Bra002149
Carica papayaevm.model.supercontig_42.121
Capsella rubellaCarubv10026126mCarubv10000564m
Citrus clementinaCiclev10025271m
Citrus sinensisorange1.1g009085m
Cucumis sativusCucsa.249950.1
Eucalyptus grandisEucgr.H04944.1
Fragaria vescamrna17879.1-v1.0-hybrid
Glycine maxGlyma05g32380.1Glyma08g15650.1Glyma06g15711.1
Gossypium raimondiiGorai.011G116400.1Gorai.003G067900.1Gorai.007G064900.1
Linum usitatissimumLus10013721Lus10033486Lus10020888Lus10005587
Malus domesticaMDP0000196867MDP0000200773MDP0000233370MDP0000297071MDP0000174996
MDP0000204084MDP0000173284MDP0000174791
Manihot esculentacassava4.1_006847mcassava4.1_004527mcassava4.1_004459mcassava4.1_021091mcassava4.1_005773m
Medicago truncatulaMedtr8g093460.1Medtr3g095920.1
Mimulus guttatusmgv1a004027mmgv1a008938mmgv1a007669mmgv1a003977mmgv1a019250m
Oryza sativaLOC_Os01g65790.1LOC_Os04g35770.1
Panicum virgatumPavirv00054696mPavirv00008464mPavirv00032807mPavirv00008364m
Physcomitrella patensPp1s382_22V6.1Pp1s216_42V6.1Pp1s151_23V6.2Pp1s76_125V6.1Pp1s151_23V6.1
Phaseolus vulgarisPhvul.002G270900.1Phvul.009G148900.1
Picea abiesMA_10430460g0010.462.762MA_10427058g0010.383.512MA_10427058g0010.383.512MA_10427058g0010.79.248MA_10427058g0010.79.248
MA_906551g0010MA_2253g0010MA_54974g0010MA_68362g0010MA_10430460g0010.462.762
MA_67675g0010MA_495624g0010
Populus trichocarpaPotri.005G061500.1Potri.007G107300.2Potri.007G107300.3Potri.007G107300.1
Prunus persicappa021056mppa024386mppa003915m
Ricinus communis30136.m001028
Setaria italicaSi005458mSi010057m
Selaginella moellendorffii8374476314420760
Sorghum bicolorSb06g017280.1Sb03g041680.1
Thellungiella halophilaThhalv10013067mThhalv10003853m
Vitis viniferaGSVIVT01026518001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)