y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna26075.1-v1.0-hybrid
FamilyGH79
Protein PropertiesLength: 541 Molecular Weight: 59463.9 Isoelectric Point: 8.3971
ChromosomeChromosome/Scaffold: 5 Start: 7450784 End: 7453625
Descriptionglucuronidase 2
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH79395340
  DNNFVCATLDWWNHEKCDYNHCPWGSASVLNLNLSHPLLAKSIQAFNQLRIRIGGSLQDQVLYGVGDLKYPCHPFRKQKGGLFGFSTGCLPMSRWDELNH
  FFSKTRPLVTFSLNALSGRHHKGAGVWVGDWDSRNAYDFINYTVSKGYQINSWELGNELCGKGVGASVGAEQYGKDLIKLKHIVNQLYNDSHIKPALVGP
  GGFFDQKWFTTLLQVSGSGVVDVVTQHIYNLGPGVDPNLMQKILNPSYLDQISGTFDSLAATVRHHGPWASIWVGESGGAYNSGGFNVSNTFVNSFWYLD
  QLGMSAMYNSAVYCRQSLVGGHYGLLNRTSFVPNPDYYSALLWHRLMGESVLKVDRNGAPHLRVYAHCSKGSAGITVLLINLSNQTDFIVNVKNVLELDR
  ADRSRSTGKGSKFSHGLKRTVSWVGLKASDGTLHRKEYHLTPKDGNLRSKIMVLNGVPLEITKDGNIPELEPVIVPVNDPISITSFSIKFVVLPHF
Full Sequence
Protein Sequence     Length: 541     Download
MELCVSLILF LVSLPAFLAK EVGHASVVVD GTVAIAHIDN NFVCATLDWW NHEKCDYNHC    60
PWGSASVLNL NLSHPLLAKS IQAFNQLRIR IGGSLQDQVL YGVGDLKYPC HPFRKQKGGL    120
FGFSTGCLPM SRWDELNHFF SKTRPLVTFS LNALSGRHHK GAGVWVGDWD SRNAYDFINY    180
TVSKGYQINS WELGNELCGK GVGASVGAEQ YGKDLIKLKH IVNQLYNDSH IKPALVGPGG    240
FFDQKWFTTL LQVSGSGVVD VVTQHIYNLG PGVDPNLMQK ILNPSYLDQI SGTFDSLAAT    300
VRHHGPWASI WVGESGGAYN SGGFNVSNTF VNSFWYLDQL GMSAMYNSAV YCRQSLVGGH    360
YGLLNRTSFV PNPDYYSALL WHRLMGESVL KVDRNGAPHL RVYAHCSKGS AGITVLLINL    420
SNQTDFIVNV KNVLELDRAD RSRSTGKGSK FSHGLKRTVS WVGLKASDGT LHRKEYHLTP    480
KDGNLRSKIM VLNGVPLEIT KDGNIPELEP VIVPVNDPIS ITSFSIKFVV LPHFEAPACG    540
*                                                                    600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03662Glyco_hydro_79n025341317+
Gene Ontology
GO TermDescription
GO:0016020membrane
GO:0016798hydrolase activity, acting on glycosyl bonds
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3vo0_A0.00008235440212427A Chain A, Crystal Structure Of A Response Regulator From Myxococcus Xanthus
PDB3vnz_A0.00008235440212427A Chain A, Crystal Structure Of A Response Regulator From Myxococcus Xanthus
PDB3vny_A0.00008235440212427A Chain A, Crystal Structure Of Beta-Glucuronidase From Acidobacterium Capsulatum
Signal Peptide
Cleavage Site
19
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_083_00009.1Aquca_002_00770.2Aquca_002_00771.1Aquca_002_00770.1Aquca_002_00770.3
Aquca_002_00771.4Aquca_002_00771.3Aquca_002_00770.4Aquca_002_00771.2.202.436Aquca_002_00771.2.202.436
Aquca_002_00771.2.40.206Aquca_002_00771.2.40.206
Arabidopsis lyrata493582496280350042497509
Arabidopsis thalianaAT5G34940.2AT5G07830.1AT5G61250.2AT5G61250.1AT5G34940.3
AT5G34940.1
Brachypodium distachyonBradi1g47760.1Bradi3g54370.1Bradi1g70300.1Bradi4g03680.1Bradi4g03680.2
Bradi1g70300.3
Brassica rapaBra038945Bra012974Bra009310
Carica papayaevm.model.supercontig_277.3evm.model.supercontig_187.5evm.model.supercontig_51.106evm.model.supercontig_51.104evm.model.supercontig_51.103
Capsella rubellaCarubv10004531mCarubv10028123mCarubv10002679m
Citrus clementinaCiclev10007919mCiclev10010401mCiclev10019606mCiclev10019304mCiclev10033641m
Citrus sinensisorange1.1g008951morange1.1g037212morange1.1g008762morange1.1g009131morange1.1g009122m
orange1.1g009113morange1.1g009102morange1.1g008834morange1.1g041499morange1.1g013838m
orange1.1g014399morange1.1g019695m
Cucumis sativusCucsa.113020.5Cucsa.113020.2Cucsa.113020.1Cucsa.132500.1Cucsa.198040.1
Cucsa.284640.1Cucsa.201230.1Cucsa.034470.1Cucsa.252720.2Cucsa.252720.1
Eucalyptus grandisEucgr.C02742.1Eucgr.K02497.1Eucgr.B00567.2Eucgr.B00567.1Eucgr.G02460.1
Eucgr.C04395.1Eucgr.B03174.1Eucgr.C02742.2Eucgr.C04395.2Eucgr.C02741.1
Eucgr.C02740.1
Fragaria vescamrna30784.1-v1.0-hybridmrna11598.1-v1.0-hybridmrna11600.1-v1.0-hybrid
Glycine maxGlyma09g11990.2Glyma09g11990.1Glyma15g23550.1Glyma13g23190.1Glyma17g11670.1
Glyma04g32745.2Glyma04g32745.1Glyma05g00663.1Glyma17g08444.1Glyma06g21551.2
Glyma06g21551.1Glyma02g12760.1Glyma02g12740.1Glyma09g11990.3Glyma05g00663.2
Glyma02g12740.2Glyma06g40075.1Glyma10g27494.1
Gossypium raimondiiGorai.004G108900.2Gorai.004G108900.1Gorai.008G196400.1Gorai.010G059600.1Gorai.006G267500.2
Gorai.006G267500.1Gorai.004G293000.2Gorai.011G285000.1Gorai.011G271100.1Gorai.004G293000.1
Gorai.N016700.1Gorai.011G285200.1Gorai.N009300.1Gorai.010G059600.2Gorai.006G004300.1
Gorai.009G305800.1Gorai.008G196400.2Gorai.006G004400.1Gorai.N021000.1Gorai.006G004500.1
Gorai.010G059600.3Gorai.N009100.1Gorai.006G004200.1Gorai.N009200.1.197.494Gorai.N009200.1.197.494
Gorai.011G284500.1.38.235Gorai.011G284500.1.38.235Gorai.006G021700.1.57.271Gorai.006G021700.1.57.271Gorai.011G284500.1.237.471
Gorai.011G284500.1.237.471Gorai.N009200.1.41.200Gorai.N009200.1.41.200Gorai.011G271700.1Gorai.006G021700.1.269.391
Gorai.006G021700.1.269.391
Linum usitatissimumLus10008823Lus10038109Lus10008038Lus10003468Lus10015737
Lus10021652Lus10034707Lus10001923Lus10004664Lus10036963
Lus10037110Lus10037109Lus10036962Lus10001952
Malus domesticaMDP0000088659MDP0000189628MDP0000242071MDP0000199066MDP0000252327
MDP0000248683
Manihot esculentacassava4.1_032464mcassava4.1_005011mcassava4.1_031502mcassava4.1_005078mcassava4.1_005072m
cassava4.1_004963mcassava4.1_021602mcassava4.1_008768m
Medicago truncatulaMedtr4g116070.1Medtr5g043710.1Medtr4g116040.1Medtr8g091920.1
Mimulus guttatusmgv1a026019mmgv1a004063mmgv1a026758mmgv1a004017mmgv1a004194m
mgv1a008019mmgv1a008017mmgv1a025097mmgv1a011158m
Oryza sativaLOC_Os06g08090.2LOC_Os06g08090.1LOC_Os02g55870.1LOC_Os12g38920.2LOC_Os12g38920.1
LOC_Os03g11320.2LOC_Os03g11320.1LOC_Os07g40740.1
Panicum virgatumPavirv00018673mPavirv00048771mPavirv00008589mPavirv00009033mPavirv00009032m
Pavirv00012019mPavirv00030038mPavirv00060468mPavirv00035109mPavirv00018674m
Pavirv00033639m
Physcomitrella patensPp1s118_67V6.1Pp1s90_137V6.1Pp1s121_77V6.1Pp1s181_80V6.1
Phaseolus vulgarisPhvul.009G212400.1Phvul.003G186600.2Phvul.003G186600.1Phvul.003G171800.1Phvul.002G081000.1
Phvul.003G171800.2Phvul.002G087100.3Phvul.002G087100.2Phvul.002G087100.1
Picea abiesMA_77698g0010MA_10433885g0020MA_93036g0020MA_854085g0010MA_71853g0010
MA_93036g0010.60.248MA_93036g0010.60.248MA_343625g0010MA_269826g0010MA_10433885g0010
MA_93036g0010.317.479MA_93036g0010.317.479
Populus trichocarpaPotri.018G121500.1Potri.018G024200.1Potri.006G062200.2Potri.006G062200.1Potri.010G160800.2
Potri.010G160800.1Potri.010G160800.3Potri.015G049100.4Potri.015G049100.3Potri.015G049100.2
Potri.015G049100.1Potri.018G121500.3Potri.018G121500.2Potri.015G049100.5Potri.010G160800.4
Potri.015G049100.6
Prunus persicappa003883mppa019445mppa003804mppa003813mppa025624m
Ricinus communis29848.m00459029720.m00013730138.m00401530174.m00914230174.m009143
Setaria italicaSi016855mSi006147mSi035072mSi035071mSi021698m
Selaginella moellendorffii10593113310032458
Sorghum bicolorSb04g036200.1Sb10g005260.1Sb01g043180.1Sb08g019250.1
Thellungiella halophilaThhalv10013186mThhalv10003960mThhalv10003449m
Vitis viniferaGSVIVT01012851001GSVIVT01007918001GSVIVT01012184001GSVIVT01035950001.36.452GSVIVT01035950001.36.452
GSVIVT01035950001.521.878GSVIVT01035950001.521.878
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)