y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna26561.1-v1.0-hybrid
FamilyCBM57
Protein PropertiesLength: 1017 Molecular Weight: 114894 Isoelectric Point: 7.1311
ChromosomeChromosome/Scaffold: 1 Start: 3783247 End: 3789033
DescriptionDi-glucose binding protein with Kinesin motor domain
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM57762088.3e-22
  MFVNAGGEGLLETSNVGFQVEGDKFFQGGNVIRTDEAIEGSDMPSIYQSARFGNFAYRFENWCPGDYFVDLHFSEIVYTNGPKGMRVFDVFMQEEKATNK
  ALQVVDVRVSVGEDGVLVIRFEGVNGSPIVSGI
Full Sequence
Protein Sequence     Length: 1017     Download
MAEPHSTTTA SHPPQFYETL TSSSPFSSTD LRRDTEPPKP ADHDGDEPLS SLCIPGSKLV    60
RTGSVLSACS DNEPVMFVNA GGEGLLETSN VGFQVEGDKF FQGGNVIRTD EAIEGSDMPS    120
IYQSARFGNF AYRFENWCPG DYFVDLHFSE IVYTNGPKGM RVFDVFMQEE KATNKALQVV    180
DVRVSVGEDG VLVIRFEGVN GSPIVSGICI KRPRLSASKV NCGNLVCNNC AAEIEISSGQ    240
EKYIRMQFIA KYEKKIEELK TWFQLKTDEC HEAWMSLTTA NKQLQDITME LDNKSYTIHC    300
LGQAREETEA KFRDISGKYE HDKRMWTAVV DKLERGVRLM KQEYYQLYCE VHKCADAVPE    360
LSNMVSAVQA MGNIRVFCRC RPLRKEESPA GHATVVQFDA AKDGELGIIS SGSNKKIFKF    420
DRVYTPEDDQ ADVFADASPM ITSVLDGYNV CIFAYGQTGT GKTFTMEGPE SNRGVNYRTL    480
EQLFIAAEER KEIFTYNISV SVLEVYNEQI RDLLATSSTS KKLEMRQSSE GTHHMPGLIE    540
AKVENIKEVW RILQAGSNAR ATGSNNVNEH SSRSHCILCI MVRAKNMMTG NCTMSKLWLV    600
DLAGSERLAK TEVQGERLKE AQNINRSLSA LGDVISALAA KKSHIPYRNS KLTRLLQDSL    660
GGDAKTLMFV QISPSEQDLN ETLSSLNFAA RVRGVELGPA KKQVDTGEVQ KLRNQNDKLK    720
QELRSKEDAL RKVEENFQNL ENKAKGDYQM CRSQQDKIDE LEKQIALKID LSRRLENQLL    780
QANEKAEAYL DLQRKVKELE HKQKENEHAY PMILHEKVKD LENKLKERTR ELEHHSAVAQ    840
WKVQELEEKL AMKENNKGFQ LLQQKVKELE EKLRWHERER ASLAFSTENS EATPIQTTCL    900
RHETVGDVNP LSQRSFSYIN QMTDHGSALL KVPESLHEIR RKREFQSKGH ENFVQPATLT    960
DGKMFSGEPN RGKSGTHKAL ARITRSIKPG TTQKSYPNIR NDRDQVPSVK SRIWLR*       1020
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd01369KISc_KHC_KIF57.0e-105371691328+
cd00106KISc2.0e-128373693329+
smart00129KISc8.0e-140373701336+
pfam00225Kinesin6.0e-140379695326+
cd01366KISc_C_terminal0371698330+
Gene Ontology
GO TermDescription
GO:0003777microtubule motor activity
GO:0005524ATP binding
GO:0007018microtubule-based movement
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2h58_A03726974330A Chain A, Crystal Structure Of The Kifc3 Motor Domain In Complex With Adp
PDB3cob_C03727135344A Chain A, Crystal Structure Of The Kifc3 Motor Domain In Complex With Adp
PDB3cob_A03727135344A Chain A, Crystal Structure Of The Kifc3 Motor Domain In Complex With Adp
PDB3cnz_B03727135344A Chain A, Crystal Structure Of The Kifc3 Motor Domain In Complex With Adp
PDB3cnz_A03727135344A Chain A, Crystal Structure Of The Kifc3 Motor Domain In Complex With Adp
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_015_00213.1Aquca_015_00213.2
Arabidopsis thalianaAT2G22610.1AT2G22610.2
Brassica rapaBra038507Bra016076
Carica papayaevm.model.supercontig_229.5evm.model.supercontig_21.41
Capsella rubellaCarubv10022542mCarubv10022541m
Citrus clementinaCiclev10000147mCiclev10024772m
Citrus sinensisorange1.1g037169morange1.1g001679m
Fragaria vescamrna20704.1-v1.0-hybrid
Glycine maxGlyma01g02620.1Glyma09g33340.2
Gossypium raimondiiGorai.008G093800.1Gorai.009G228400.1Gorai.002G032500.3Gorai.002G032500.2Gorai.002G032500.1
Linum usitatissimumLus10005582Lus10035954Lus10025708Lus10013714
Malus domesticaMDP0000317970
Manihot esculentacassava4.1_032042mcassava4.1_000724m
Medicago truncatulaAC174330_12.1AC146711_18.1AC146711_37.1Medtr5g031470.1
Mimulus guttatusmgv1a000533m
Physcomitrella patensPp1s9_137V6.1Pp1s403_54V6.1
Phaseolus vulgarisPhvul.002G145000.1
Picea abiesMA_180169g0010
Populus trichocarpaPotri.002G110600.2Potri.011G140000.1Potri.001G436200.1Potri.001G436200.2Potri.001G436200.4
Potri.002G110600.1
Prunus persicappa014706mppa015110m
Ricinus communis29591.m00013929235.m00023229596.m000713
Selaginella moellendorffii13900998850
Vitis viniferaGSVIVT01003948001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny