y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna26581.1-v1.0-hybrid
FamilyPL4
Protein PropertiesLength: 1429 Molecular Weight: 162698 Isoelectric Point: 5.5961
ChromosomeChromosome/Scaffold: 1 Start: 3928096 End: 3943257
DescriptionRhamnogalacturonate lyase family protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
PL481414060
  SSLQVIMDNGIVQVTLSNPGGIVTGIQYKGIDNLLEVLNEEANRGYWDLVWSETGSIGTTGTYDRIVGTKFTVIVESEEQVEISFTREWNHDDMNVPLNI
  DKRFVMLRNSSGFYSYAIYEHLKEWPAFNLPQTRITFKLRKEMFQYMAIADNRQRNMPLPDDRLPERSQILNSDFPEAVLLVNPIEPQYKGEVDDKYQYS
  CENQNLRVHGWICKDPHVGFWQITPSDEFRSGGPLKQNLTSHVGPICLAMFLSAHYSGEDLVLKLKPDEPWKKVFGPVFIYLNSSSDEKDSSPLWEDAKK
  QMMTEVQSWPYEFPASSDFPTSKQRGNVSGGILVRDGDHHILGDGAYVGLAPPGDVGSWQRDCKGYQFWTRVDENGYYSIKNIREGNYNLYAWVPGFIGD
  YRYGVAINITPGCDIQLGDLVYEPPRDGPTLWEIGFPDRTATGFYVPDPNPKFRQWGLWERYAELYPKEDLVYTIGTSDYSKDWFFAQVTRKKDDGTYQG
  TSWKINFQIDNVNQTKTHKLRVALATANIAELQIRVNDSNADTPLFTTGVIGHDNAICRHGIHGLYRLYSINVPGTLLAKGDNTVFLTQAMST
PL41677700
  HVVMNNDILQVNLSKPQGMVTGIQYKGIDNLLEVLEDETNRGYWDLVWSAPGITRKKGAFDRIEGTNFTVIVETEDQIELSFTRMWDPSLEGKVVPLNID
  KRFVLLRNSSGFYTYAIYEHLNEWPAFNLTNTRTVFKLRKDKFHYMAISDTRQRHMPLPDDRSAERGQALAYPEAVLLVNPVEPEFKGEVDDKYQYSIEN
  MYNRVHGWIANDSQVGFWQITPSEEFKTGGPFKQCLTSHVGPTTLAIFHSTHYSGEELILQFGTNEPWKKVLGPVFFYLNSLVNGTTNPIQRLWEDAKQE
  MNDEVERWPYDFPASKDFLSPKQRGAVRGSLLVRERYVTDDKDVPGNGTWVGLAAPGVVGSWQLECKGYQFWTKADSNGYFSIHGVRPGTYNLYAWVPGF
  IGDYRDVSEVVVTPDGDVDVGTLVYEPPRTGPTLWEIGIPDRTAAEFYVPDPNPKYINKLYVNHTDRFRQYGLWERYAELYPDNDLVYTIGVSDYTKDFF
  FAQVTRKMGNNTYKGSTWQIKFNLGNVDKNTTYTLRISLATAHVSELQVRINDPETKNPPLFTTGEIGNDNTIARHGIHGLYRLYSVDIPSALLVEGNNT
  IFLT
Full Sequence
Protein Sequence     Length: 1429     Download
MSFSGYEPVQ LCLISDDGPR PICTLVLSDE IVVMKNIRFW RQDAEMMRML EIWSRKDSCG    60
GNACKYTTVF KNWGAIEAPR GGNRNLDVVA VAASGRMTLS SNAKPIGLAC SFWAGDKILR    120
PYLEPENEQR TNPPHFFAFH DNMDFCKAGY HDSSSPLLQP FISGWEHVVM NNDILQVNLS    180
KPQGMVTGIQ YKGIDNLLEV LEDETNRGYW DLVWSAPGIT RKKGAFDRIE GTNFTVIVET    240
EDQIELSFTR MWDPSLEGKV VPLNIDKRFV LLRNSSGFYT YAIYEHLNEW PAFNLTNTRT    300
VFKLRKDKFH YMAISDTRQR HMPLPDDRSA ERGQALAYPE AVLLVNPVEP EFKGEVDDKY    360
QYSIENMYNR VHGWIANDSQ VGFWQITPSE EFKTGGPFKQ CLTSHVGPTT LAIFHSTHYS    420
GEELILQFGT NEPWKKVLGP VFFYLNSLVN GTTNPIQRLW EDAKQEMNDE VERWPYDFPA    480
SKDFLSPKQR GAVRGSLLVR ERYVTDDKDV PGNGTWVGLA APGVVGSWQL ECKGYQFWTK    540
ADSNGYFSIH GVRPGTYNLY AWVPGFIGDY RDVSEVVVTP DGDVDVGTLV YEPPRTGPTL    600
WEIGIPDRTA AEFYVPDPNP KYINKLYVNH TDRFRQYGLW ERYAELYPDN DLVYTIGVSD    660
YTKDFFFAQV TRKMGNNTYK GSTWQIKFNL GNVDKNTTYT LRISLATAHV SELQVRINDP    720
ETKNPPLFTT GEIGNDNTIA RHGIHGLYRL YSVDIPSALL VEGNNTIFLT RELSVSPFQG    780
IISRQRGRSY KVENTYAMKI SSHKQRLMQH QNFSSLQVIM DNGIVQVTLS NPGGIVTGIQ    840
YKGIDNLLEV LNEEANRGYW DLVWSETGSI GTTGTYDRIV GTKFTVIVES EEQVEISFTR    900
EWNHDDMNVP LNIDKRFVML RNSSGFYSYA IYEHLKEWPA FNLPQTRITF KLRKEMFQYM    960
AIADNRQRNM PLPDDRLPER SQILNSDFPE AVLLVNPIEP QYKGEVDDKY QYSCENQNLR    1020
VHGWICKDPH VGFWQITPSD EFRSGGPLKQ NLTSHVGPIC LAMFLSAHYS GEDLVLKLKP    1080
DEPWKKVFGP VFIYLNSSSD EKDSSPLWED AKKQMMTEVQ SWPYEFPASS DFPTSKQRGN    1140
VSGGILVRDG DHHILGDGAY VGLAPPGDVG SWQRDCKGYQ FWTRVDENGY YSIKNIREGN    1200
YNLYAWVPGF IGDYRYGVAI NITPGCDIQL GDLVYEPPRD GPTLWEIGFP DRTATGFYVP    1260
DPNPKFRQWG LWERYAELYP KEDLVYTIGT SDYSKDWFFA QVTRKKDDGT YQGTSWKINF    1320
QIDNVNQTKT HKLRVALATA NIAELQIRVN DSNADTPLFT TGVIGHDNAI CRHGIHGLYR    1380
LYSINVPGTL LAKGDNTVFL TQAMSTSPFV GIMYDYIRLE APSSSTSA*                1440
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd10317RGL4_C2.0e-5112451420178+
cd10320RGL4_N3.0e-658141104292+
cd10320RGL4_N2.0e-68167447284+
pfam06045Rhamnogal_lyase2.0e-798171006191+
pfam06045Rhamnogal_lyase3.0e-90164356193+
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3njx_A0.001536769283483A Chain A, Rhamnogalacturonan Lyase From Aspergillus Aculeatus Mutant H210a
PDB3njv_A0.001536769283483A Chain A, Rhamnogalacturonan Lyase From Aspergillus Aculeatus Mutant H210a
PDB2xhn_B0.001536769283483A Chain A, Rhamnogalacturonan Lyase From Aspergillus Aculeatus K150a Active Site Mutant
PDB2xhn_A0.001536769283483A Chain A, Rhamnogalacturonan Lyase From Aspergillus Aculeatus K150a Active Site Mutant
PDB1nkg_A0.001536769283483A Chain A, Rhamnogalacturonan Lyase From Aspergillus Aculeatus
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_010_00069.4Aquca_010_00069.3Aquca_010_00069.1Aquca_010_00069.2Aquca_010_00071.1
Aquca_056_00097.1Aquca_008_00160.5Aquca_008_00159.1Aquca_008_00160.2Aquca_008_00160.4
Aquca_008_00160.3Aquca_008_00160.1Aquca_005_00010.1Aquca_010_00071.2Aquca_023_00190.1
Aquca_010_00070.1Aquca_023_00190.2
Arabidopsis lyrata888241334271481121354330879190
353036315485912531
Arabidopsis thalianaAT1G09910.1AT1G09890.1AT2G22620.1AT4G24430.1AT1G09880.1
AT4G37950.1AT4G38030.1AT2G22620.2AT1G65210.1
Brachypodium distachyonBradi3g42610.1Bradi3g24670.1.25.224Bradi3g24670.1.25.224Bradi4g26420.1Bradi3g57440.1
Bradi3g24670.1.227.515Bradi3g24670.1.227.515
Brassica rapaBra019976Bra019978Bra019979Bra013800Bra038506
Bra030804Bra011802Bra010630.46.641Bra010630.46.641Bra010629
Bra003366Bra010630.640.880Bra010630.640.880Bra010624.235.480Bra010624.235.480
Bra010624.235.480Bra010624.49.234Bra010624.49.234Bra010624.49.234
Carica papayaevm.model.supercontig_177.18evm.model.supercontig_177.19evm.TU.contig_29377.1evm.model.supercontig_21.45evm.model.supercontig_152.24
evm.TU.contig_29377.2evm.model.supercontig_129.7
Capsella rubellaCarubv10008508mCarubv10010965mCarubv10022775mCarubv10007831mCarubv10008518m
Carubv10007197mCarubv10022113mCarubv10004306m
Citrus clementinaCiclev10000543mCiclev10003131mCiclev10000542mCiclev10003466mCiclev10003807m
Ciclev10025074mCiclev10017592mCiclev10006424mCiclev10003567mCiclev10027111m
Ciclev10006636m
Citrus sinensisorange1.1g042458morange1.1g005706morange1.1g006741morange1.1g007269morange1.1g047026m
orange1.1g037887morange1.1g006927morange1.1g038979morange1.1g010135morange1.1g011661m
orange1.1g011825morange1.1g040991m
Cucumis sativusCucsa.312090.1Cucsa.312070.3Cucsa.312070.1Cucsa.312070.2Cucsa.160470.1
Cucsa.103830.1Cucsa.312080.1Cucsa.045150.2Cucsa.045150.1Cucsa.045150.3
Cucsa.260200.1Cucsa.260200.2
Eucalyptus grandisEucgr.F00442.2Eucgr.F00442.1Eucgr.F00441.1Eucgr.I00574.2Eucgr.I00574.1
Eucgr.F00438.2Eucgr.F00438.1Eucgr.F00439.2Eucgr.F00439.1Eucgr.D01343.1
Eucgr.H02416.1.178.655Eucgr.H02416.1.178.655
Fragaria vescamrna26587.1-v1.0-hybrid.575.949mrna26587.1-v1.0-hybrid.575.949mrna26587.1-v1.0-hybrid.575.949mrna26581.1-v1.0-hybrid.167.770mrna26581.1-v1.0-hybrid.167.770
mrna31031.1-v1.0-hybrid.42.277mrna31031.1-v1.0-hybrid.42.277mrna05694.1-v1.0-hybridmrna19639.1-v1.0-hybridmrna24966.1-v1.0-hybrid.55.661
mrna24966.1-v1.0-hybrid.55.661mrna31030.1-v1.0-hybridmrna26580.1-v1.0-hybridmrna26077.1-v1.0-hybridmrna31031.1-v1.0-hybrid.280.619
mrna31031.1-v1.0-hybrid.280.619mrna26585.1-v1.0-hybridmrna26587.1-v1.0-hybrid.381.517mrna26587.1-v1.0-hybrid.381.517mrna26587.1-v1.0-hybrid.381.517
Glycine maxGlyma06g09760.3Glyma06g09760.2Glyma06g09770.3Glyma06g09770.1Glyma04g09670.1
Glyma04g09680.1Glyma04g09680.2Glyma02g38050.1Glyma18g27090.4Glyma18g27090.3
Glyma18g27090.2Glyma01g02560.1Glyma09g33400.3Glyma09g33400.2Glyma08g37410.1
Glyma08g37420.2Glyma04g09660.2.40.282Glyma04g09660.2.40.282Glyma04g09660.2.283.511Glyma04g09660.2.283.511
Glyma02g38061.1.329.504Glyma02g38061.1.329.504Glyma14g36201.1.210.328Glyma14g36201.1.210.328
Gossypium raimondiiGorai.010G032900.1Gorai.010G032900.2Gorai.009G227700.1Gorai.002G138200.5Gorai.002G138200.4
Gorai.002G138200.1Gorai.010G033000.1Gorai.009G227800.2Gorai.009G227700.2Gorai.009G227800.1
Gorai.002G138200.2Gorai.007G231600.1Gorai.007G231600.2Gorai.003G036400.1Gorai.007G231600.3
Gorai.008G089300.3Gorai.008G089300.1Gorai.008G089300.2Gorai.003G036600.1Gorai.002G138200.3
Gorai.008G089100.1
Linum usitatissimumLus10000684Lus10028212Lus10039627Lus10019231Lus10004281
Lus10030233Lus10000129Lus10012720Lus10000111Lus10005979
Lus10029552Lus10023106Lus10030232Lus10005978.157.600Lus10005978.157.600
Lus10010739Lus10042916Lus10010738.186.385Lus10010738.186.385Lus10010738.15.184
Lus10010738.15.184Lus10010628
Malus domesticaMDP0000121223MDP0000910440MDP0000726337.390.638MDP0000726337.390.638MDP0000726337.390.638
MDP0000310168MDP0000253529MDP0000600662MDP0000816794MDP0000265455
MDP0000144890MDP0000221905MDP0000280501.221.597MDP0000280501.221.597MDP0000661406
MDP0000186551MDP0000161615MDP0000726337.184.393MDP0000726337.184.393MDP0000726337.184.393
MDP0000502670MDP0000315307
Manihot esculentacassava4.1_003508mcassava4.1_003506mcassava4.1_031112mcassava4.1_028655mcassava4.1_029675m
cassava4.1_021251mcassava4.1_026462mcassava4.1_029993mcassava4.1_026195mcassava4.1_031565m
cassava4.1_021266m.240.400cassava4.1_021266m.240.400
Medicago truncatulaMedtr3g111410.1Medtr3g111420.1Medtr5g066770.1Medtr3g111380.1Medtr8g068110.1
Medtr8g068120.1Medtr8g068160.1Medtr5g031170.1
Mimulus guttatusmgv1a002779mmgv1a002710mmgv1a002454mmgv1a003154mmgv1a022558m
mgv1a002827mmgv1a019191mmgv1a002612mmgv1a018512mmgv1a023316m
mgv1a019441mmgv1a025746m
Oryza sativaLOC_Os08g44020.3LOC_Os08g44020.2LOC_Os08g44020.1LOC_Os08g44040.1
Panicum virgatumPavirv00037365mPavirv00030733mPavirv00008158mPavirv00023932mPavirv00012626m
Pavirv00032832mPavirv00051498mPavirv00066561mPavirv00016001m
Physcomitrella patensPp1s117_149V6.1Pp1s60_134V6.1
Phaseolus vulgarisPhvul.009G144900.2Phvul.009G144900.1Phvul.009G144800.1Phvul.009G144700.1Phvul.003G287200.1
Phvul.008G183500.1Phvul.002G144400.1Phvul.009G144900.3Phvul.003G287300.1
Picea abiesMA_2550g0010MA_10429122g0010MA_10434775g0010MA_228529g0010MA_10429048g0010
Populus trichocarpaPotri.005G151500.2Potri.005G151500.3Potri.005G151500.1Potri.002G110000.1Potri.011G006200.1
Potri.002G110200.2Potri.002G110200.1Potri.014G004500.3Potri.014G004500.1Potri.014G004500.2
Potri.006G218500.1Potri.002G110100.1Potri.006G253600.3Potri.006G253600.2Potri.002G110300.2
Potri.002G110300.1Potri.006G218500.2Potri.002G110000.2Potri.006G253600.1.352.549Potri.006G253600.1.352.549
Potri.005G151600.1
Prunus persicappa002905mppa026307mppa002544mppa002538mppa002258m
ppa022021mppa014556m
Ricinus communis29596.m00070129596.m00070229596.m00070729596.m00070628333.m000588
29596.m00070528333.m00057229842.m003574.19.21929842.m003574.19.21929842.m003574.232.356
29842.m003574.232.356
Setaria italicaSi013393mSi013400mSi012557mSi027699mSi024658m
Si027587m
Selaginella moellendorffii130257425248413798413794.293.533413794.293.533
Sorghum bicolorSb07g024560.1Sb08g001440.1Sb09g030850.1Sb05g001996.1Sb05g018090.1
Sb05g001980.1
Thellungiella halophilaThhalv10007058mThhalv10007093mThhalv10000697mThhalv10007038mThhalv10024647m
Thhalv10027081mThhalv10024612mThhalv10007521m
Vitis viniferaGSVIVT01009215001GSVIVT01012710001GSVIVT01006298001GSVIVT01006302001.272.736GSVIVT01006302001.272.736
GSVIVT01006463001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)