y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna26605.1-v1.0-hybrid
FamilyCBM43
Protein PropertiesLength: 173 Molecular Weight: 18733 Isoelectric Point: 7.9827
ChromosomeChromosome/Scaffold: 7 Start: 15689304 End: 15690165
Descriptionglycosyl hydrolase family 17 protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM43891681.1e-31
  WCVAKPHSDTDTLDKHLDWLCGMVECQAIKPGGACYDESIRAQASFAMNSYYQTKGRNDNNCDFSGTAVITTVDPSHGPC
Full Sequence
Protein Sequence     Length: 173     Download
MSTERDLKTR ASFAMNAFYN LYRSLGGTCD FSGSGQIINT DPSTFSCKFV ASDGDSGSKL    60
PPRNVYNPKP IPKTPKRSVL GGDGPVRKWC VAKPHSDTDT LDKHLDWLCG MVECQAIKPG    120
GACYDESIRA QASFAMNSYY QTKGRNDNNC DFSGTAVITT VDPSHGPCHY LS*           180
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam07983X80.000283528+
smart00768X82.0e-1264944+
pfam07983X84.0e-198815777+
smart00768X81.0e-318817085+
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2jon_A7e-20891721398A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_015_00316.1.375.457Aquca_010_00473.1.377.458Aquca_037_00225.1.384.465Aquca_022_00080.1Aquca_027_00361.1.370.452
Aquca_022_00111.1Aquca_003_00044.1.385.467Aquca_002_00835.1Aquca_010_00473.2.377.449
Arabidopsis lyrata483480876708489799889285316754
347193918444918445332548.93.174332548.93.174
921012485970.366.448915838483478321648.455.536
321648.455.536332548.26.90332548.26.90901946321648.356.437
321648.356.437894388497543496508351455.358.440
894393919614333412350051480794.366.444
919353894381894389920460894710
471542904630890098
Arabidopsis thalianaAT4G34480.1.364.445AT2G16230.1.366.447AT2G43670.1AT1G78520.1AT4G09090.1
AT4G09462.1AT4G09467.1AT4G09464.1AT4G09465.1AT3G28250.1
AT4G09466.1AT5G53610.1AT5G53600.1AT2G43660.2AT2G43660.1
AT5G63225.1AT4G16165.1AT5G63230.1AT2G39640.1.460.541AT2G39640.1.460.541
AT2G39640.1.359.440AT2G39640.1.359.440AT1G66870.1AT5G63240.1AT5G63250.1
AT3G55430.1.366.448AT5G24318.1.372.454AT1G66852.1AT1G18650.1AT5G24318.2.372.450
AT5G61130.1AT1G66855.1AT5G08000.1AT1G69295.1AT2G03505.1
AT1G13830.1AT1G26450.1
Brachypodium distachyonBradi1g12810.1.375.457Bradi2g08580.1Bradi3g14430.3Bradi3g14430.2Bradi3g14430.1
Bradi4g09230.1.390.471Bradi1g08230.1Bradi5g26467.1.387.474Bradi4g09230.2.390.468Bradi1g16230.1
Brassica rapaBra017659.418.499Bra011537.369.450Bra036510.361.443Bra014082Bra003212.365.448
Bra007161.369.452Bra014747.367.449Bra007162.368.447Bra025675Bra035043
Bra038618Bra039998Bra036081Bra029334Bra035941
Bra016548Bra012981Bra009313Bra039852.370.448Bra005028.356.435
Bra012458Bra016724Bra038314Bra026880Bra004003
Bra004369Bra025116Bra019700Bra026879Bra026878
Carica papayaevm.model.supercontig_36.69.377.459evm.model.supercontig_62.143.362.444evm.model.supercontig_26.161.352.430evm.model.supercontig_81.143.366.448evm.model.supercontig_3.108.376.459
evm.model.supercontig_1272.1evm.model.supercontig_1.407.360.441evm.model.supercontig_94.45evm.model.supercontig_1.118
Capsella rubellaCarubv10005030m.248.329Carubv10015799m.362.443Carubv10021581mCarubv10025243mCarubv10017225m.370.453
Carubv10024804mCarubv10003182mCarubv10024539mCarubv10002428mCarubv10028110m
Carubv10002725mCarubv10003588mCarubv10021377mCarubv10025630mCarubv10022451m
Carubv10021358mCarubv10027463mCarubv10025141m.451.533Carubv10025141m.451.533Carubv10000922m.374.456
Carubv10021806mCarubv10027366mCarubv10021306mCarubv10027167mCarubv10002008m
Carubv10025141m.355.437Carubv10025141m.355.437Carubv10012483mCarubv10012551mCarubv10017928m
Carubv10020897mCarubv10010353m
Citrus clementinaCiclev10001687m.262.344Ciclev10028372m.379.460Ciclev10003630m.338.419Ciclev10022784mCiclev10022921m
Ciclev10017518mCiclev10017622mCiclev10028241m.382.463Ciclev10017969mCiclev10017995m
Ciclev10017980mCiclev10020075m.377.459Ciclev10033472m.365.446Ciclev10032483m
Citrus sinensisorange1.1g011390m.400.482orange1.1g019362m.254.335orange1.1g012262m.379.460orange1.1g040787m.338.419orange1.1g032550m
orange1.1g034483morange1.1g033263morange1.1g037583m.382.463orange1.1g047957m.36.117orange1.1g047957m.36.117
orange1.1g048472morange1.1g047957m.133.210orange1.1g047957m.133.210orange1.1g039834morange1.1g043079m.377.459
orange1.1g038452m.354.435orange1.1g029582m
Cucumis sativusCucsa.109660.1.376.457Cucsa.342270.1.390.472Cucsa.117900.1.363.445Cucsa.058100.1Cucsa.165390.1.363.440
Cucsa.198190.2Cucsa.198190.1Cucsa.202330.1.409.491Cucsa.327840.1Cucsa.284540.1
Eucalyptus grandisEucgr.G00445.1.382.463Eucgr.F01563.3.264.345Eucgr.F01563.2.386.467Eucgr.F03575.1.378.460Eucgr.F01563.1.386.463
Eucgr.F01381.1Eucgr.A01020.2Eucgr.A01020.3Eucgr.A01020.1Eucgr.B02367.1.375.456
Eucgr.B02367.2.375.455Eucgr.J00013.1.367.448Eucgr.A01445.1.391.472Eucgr.G02452.1Eucgr.B03157.1
Fragaria vescamrna20426.1-v1.0-hybrid.475.557mrna31503.1-v1.0-hybrid.383.461mrna30557.1-v1.0-hybridmrna30558.1-v1.0-hybrid.40.123mrna30558.1-v1.0-hybrid.40.123
mrna26603.1-v1.0-hybrid.363.444mrna30558.1-v1.0-hybrid.140.221mrna30558.1-v1.0-hybrid.140.221mrna30559.1-v1.0-hybrid.136.216mrna30559.1-v1.0-hybrid.136.216
mrna26607.1-v1.0-hybrid.410.490mrna15136.1-v1.0-hybrid.392.474mrna22973.1-v1.0-hybridmrna14081.1-v1.0-hybrid.385.466mrna12825.1-v1.0-hybrid.381.456
mrna16853.1-v1.0-hybridmrna26604.1-v1.0-hybrid.26.107mrna26604.1-v1.0-hybrid.26.107mrna26604.1-v1.0-hybrid.26.107
Glycine maxGlyma12g04800.2.346.428Glyma12g04800.1.255.337Glyma06g01500.3.231.312Glyma06g01500.2.371.452Glyma06g01500.1.371.452
Glyma04g01450.1.371.452Glyma14g08200.1.396.477Glyma13g33720.1Glyma15g39060.1Glyma05g25840.1
Glyma06g21982.1Glyma18g52860.1.371.453Glyma18g52860.2.371.450Glyma17g08570.1Glyma05g00470.2
Glyma05g00470.1Glyma20g03100.1Glyma02g12950.2Glyma02g12950.1Glyma01g07100.1
Glyma07g35230.1Glyma08g11825.1
Gossypium raimondiiGorai.002G114200.1.369.451Gorai.005G243100.4.235.316Gorai.005G243100.2.368.449Gorai.006G090600.1.360.441Gorai.005G243100.1.368.446
Gorai.008G135800.2Gorai.008G135800.1Gorai.013G263800.1.384.466Gorai.009G360300.1Gorai.002G044300.2
Gorai.002G044300.1Gorai.011G041500.1Gorai.009G010800.1.359.440Gorai.003G101000.1Gorai.010G239200.1.152.233
Gorai.010G239200.1.152.233Gorai.010G239200.1.55.136Gorai.010G239200.1.55.136Gorai.009G202900.2.384.465Gorai.009G202900.1.384.462
Gorai.006G202300.1.426.508Gorai.011G261100.1Gorai.011G260900.1Gorai.013G093600.3Gorai.013G093600.2
Gorai.013G093600.1Gorai.008G177700.1Gorai.011G261200.1Gorai.009G326600.2Gorai.009G326600.1
Linum usitatissimumLus10040461.376.458Lus10023576.374.456Lus10012080.395.475Lus10016032.390.469Lus10021157
Lus10040522Lus10042492Lus10026175Lus10040294.362.444Lus10005166.448.526
Lus10008865.358.440Lus10004962.370.452Lus10005459.235.317Lus10016539.377.459Lus10040808.378.460
Lus10034690Lus10021619Lus10023245.361.443Lus10039923Lus10032719.266.346
Lus10037071Lus10036914Lus10026662Lus10004650
Malus domesticaMDP0000146863.371.453MDP0000321387.394.472MDP0000179206.339.417MDP0000279434MDP0000131669
MDP0000754160.393.474MDP0000543964.370.451MDP0000676131.386.467MDP0000379414MDP0000136027
MDP0000399053.489.567MDP0000289320MDP0000323489MDP0000323490MDP0000163137
MDP0000153001
Manihot esculentacassava4.1_007302m.370.451cassava4.1_007509m.362.443cassava4.1_011788m.238.320cassava4.1_007157m.375.457cassava4.1_033885m
cassava4.1_006146m.374.456cassava4.1_007570m.364.446cassava4.1_028471mcassava4.1_021354mcassava4.1_028386m
cassava4.1_022539mcassava4.1_030302m.372.454cassava4.1_028382m.397.474cassava4.1_016458mcassava4.1_016746m
cassava4.1_016034mcassava4.1_017159m
Medicago truncatulaMedtr4g069940.1.375.457Medtr8g085420.1Medtr3g116510.2.371.453Medtr3g116510.1.389.471Medtr7g026340.1.365.446
Medtr4g083500.1.383.465Medtr4g083070.2Medtr4g083070.1Medtr5g044530.1
Mimulus guttatusmgv1a006001m.373.454mgv1a016668mmgv1a006105m.372.454mgv1a006294m.364.446mgv1a020101m
mgv1a020042mmgv1a013571m
Oryza sativaLOC_Os03g46660.1.430.512LOC_Os01g14140.1LOC_Os04g58555.1LOC_Os08g04140.2LOC_Os08g04140.1
LOC_Os11g47820.2.347.428LOC_Os11g47820.1.388.469
Panicum virgatumPavirv00002759mPavirv00067089m.206.286Pavirv00065452mPavirv00031319mPavirv00045086m
Pavirv00040284mPavirv00052940mPavirv00029831m.385.466Pavirv00056154mPavirv00056153m
Pavirv00066921mPavirv00066920mPavirv00066919mPavirv00062317mPavirv00017870m
Pavirv00017869mPavirv00044154m.268.338Pavirv00042842mPavirv00036341m
Physcomitrella patensPp1s51_57V6.1.428.510Pp1s150_19V6.1.431.513Pp1s1_72V6.2.361.444Pp1s1_72V6.1.361.444
Phaseolus vulgarisPhvul.011G045800.1.370.452Phvul.001G014900.1.385.466Phvul.009G024000.1.369.450Phvul.005G064400.1Phvul.003G185300.1
Phvul.002G196100.1Phvul.008G010600.1.360.442Phvul.002G099500.1.381.463Phvul.009G192000.1Phvul.003G043000.1
Phvul.002G102400.1
Picea abiesMA_67006g0010.395.473MA_11716g0010.394.475MA_83329g0010.388.469MA_9501830g0010MA_8038g0010.405.487
MA_10429655g0010MA_279076g0010
Populus trichocarpaPotri.008G056000.1.370.451Potri.002G007300.1.373.456Potri.004G153800.1.368.447Potri.009G115400.5.232.313Potri.009G115400.2.364.445
Potri.002G261800.2.401.482Potri.002G261800.1.401.482Potri.009G115400.1.364.442Potri.008G055900.1.364.446Potri.014G114500.1
Potri.011G099000.1Potri.005G253900.1.317.395Potri.001G351600.1Potri.001G380600.1Potri.011G100300.1
Potri.008G055900.2.364.442Potri.010G158900.3Potri.010G158900.2Potri.010G158900.1Potri.011G099600.1
Potri.011G099900.1Potri.001G240000.1.370.451Potri.001G240000.2.370.448Potri.012G017800.2.376.459Potri.012G017800.1.379.462
Potri.012G065700.1Potri.015G057800.1Potri.015G010100.1.374.450Potri.008G095300.1
Prunus persicappa005142m.388.470ppa005375m.376.457ppa013618mppa017757mppa015282m
ppa027174mppa015278mppa004320m.396.477ppa005160m.390.471ppa004976m.395.476
ppa023079m.387.469ppa011545m
Ricinus communis30190.m010891.372.45330170.m013711.371.45329989.m00042929977.m000251.361.44330003.m000340.373.454
30170.m014027.373.45430003.m000339.362.44029693.m00203030076.m00457529693.m002049.32.113
29693.m002049.32.11329693.m002049.134.21429693.m002049.134.21429693.m002048.114.19129693.m002048.114.191
30138.m00398129753.m000250.388.46630174.m009116
Setaria italicaSi035582m.373.455Si026317m.389.470Si021971m.381.463Si035430m.380.460Si012108m
Si014645mSi003126mSi037676m
Selaginella moellendorffii115863438073.409.49119025437861.333.41694863.374.453
69045496605975273476.373.45238965
389693896869709
Sorghum bicolorSb01g012380.1.386.468Sb06g033250.1.379.462Sb05g027690.1.383.464Sb01g007670.1Sb03g000270.1
Sb06g020000.1Sb07g002710.1
Thellungiella halophilaThhalv10024968m.370.451Thhalv10022641m.383.464Thhalv10011991mThhalv10019333mThhalv10001721m
Thhalv10010363m.372.455Thhalv10008839mThhalv10004907mThhalv10005328mThhalv10012146m
Thhalv10017796mThhalv10017897m.358.439Thhalv10005350mThhalv10019456mThhalv10005544m
Thhalv10004182m.379.456Thhalv10014742mThhalv10005040mThhalv10008841mThhalv10019091m
Thhalv10008701m
Vitis viniferaGSVIVT01009700001.377.458GSVIVT01031959001.404.485GSVIVT01013401001.398.480GSVIVT01016553001.321.403GSVIVT01014068001
GSVIVT01007873001GSVIVT01021412001GSVIVT01038583001.375.457GSVIVT01012212001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)