y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna26801.1-v1.0-hybrid
FamilyGH1
Protein PropertiesLength: 297 Molecular Weight: 34108.7 Isoelectric Point: 8.9654
ChromosomeChromosome/Scaffold: 7 Start: 5469243 End: 5470760
Descriptionbeta glucosidase 17
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH112940
  MNEPNGIAINGYNGGTIAPGRCSNYEGNCTSGNSATEPYIAAHHLLLAHSAAVKIYKDKYQATQKGQIGITIITLWCKPKFPEQLASRRATLRSLDFMFG
  WFANPIFHGDYPAVMKSLVGDRLPKFTEAESKQIKGSLDFLGLNYYTAYYTVDEPALSNAVNHSWSADRQTDLDWLFVYPKGIRDVLLYIKEKYNNPNIY
  ITENGYPYGYNASTPIQEARKDNLRIRYHHDHLWYLLKAIKNGVKVKGYYAWSFWDDFEWDTGYTVGFGLTLVDVKDNLKRYLKYSAYWYKMFL
Full Sequence
Protein Sequence     Length: 297     Download
MNEPNGIAIN GYNGGTIAPG RCSNYEGNCT SGNSATEPYI AAHHLLLAHS AAVKIYKDKY    60
QATQKGQIGI TIITLWCKPK FPEQLASRRA TLRSLDFMFG WFANPIFHGD YPAVMKSLVG    120
DRLPKFTEAE SKQIKGSLDF LGLNYYTAYY TVDEPALSNA VNHSWSADRQ TDLDWLFVYP    180
KGIRDVLLYI KEKYNNPNIY ITENGYPYGY NASTPIQEAR KDNLRIRYHH DHLWYLLKAI    240
KNGVKVKGYY AWSFWDDFEW DTGYTVGFGL TLVDVKDNLK RYLKYSAYWY KMFLLH*       300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR03356BGL2.0e-5186290207+
PLN02998PLN029981.0e-521294306+
PLN02814PLN028143.0e-531294306+
PLN02849PLN028498.0e-621294303+
pfam00232Glyco_hydro_12.0e-682291304+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ptq_B01295196504A Chain A, Pectin Methylesterase From Yersinia Enterocolitica
PDB3ptq_A01295196504A Chain A, Pectin Methylesterase From Yersinia Enterocolitica
PDB3ptm_B01295196504A Chain A, Pectin Methylesterase From Yersinia Enterocolitica
PDB3ptm_A01295196504A Chain A, Pectin Methylesterase From Yersinia Enterocolitica
PDB3ptk_B01295196504A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_346_00002.1
Eucalyptus grandisEucgr.K00923.1
Glycine maxGlyma11g13766.2Glyma08g15960.5Glyma08g15993.1Glyma08g15960.4Glyma08g15950.2
Gossypium raimondiiGorai.008G271500.8.159.363Gorai.008G271500.8.159.363
Linum usitatissimumLus10011828.473.717Lus10000225Lus10011828.473.717
Malus domesticaMDP0000285510MDP0000295323MDP0000187265
Medicago truncatulaMedtr4g015460.2
Mimulus guttatusmgv1a025884mmgv1a014264m
Oryza sativaLOC_Os04g39814.3
Panicum virgatumPavirv00040514mPavirv00034317mPavirv00068709m
Phaseolus vulgarisPhvul.011G055700.2
Picea abiesMA_173229g0010
Populus trichocarpaPotri.T019200.1.296.514Potri.T177800.2Potri.T019200.1.296.514Potri.T177800.1Potri.T177800.3
Prunus persicappa026358mppa015721m
Vitis viniferaGSVIVT01032017001GSVIVT01032006001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny