y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna27049.1-v1.0-hybrid
FamilyGH17
Protein PropertiesLength: 210 Molecular Weight: 22873.3 Isoelectric Point: 9.3213
ChromosomeChromosome/Scaffold: 3 Start: 15042068 End: 15048993
DescriptionO-Glycosyl hydrolases family 17 protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH171362081.7e-23
  IGANWGTQASHPLPPDSVVSLLRQNGIQKVKLFNADYDTLTTLGKSGIEVMVGIPNDMLASLASSVKAAEKWV
Full Sequence
Protein Sequence     Length: 210     Download
MQPSENGGAS VLRDGDQRSV ALPTPLVLMV RDRSSAAQRD RAGEEASTKL VLESADLRTL    60
LADLRTLLVD LRMLQATSTS LVAEARWRCE KEDKWTRRRC RWRRLGGNGE VFSGGISIWV    120
VFLISNLMMC GVVSGIGANW GTQASHPLPP DSVVSLLRQN GIQKVKLFNA DYDTLTTLGK    180
SGIEVMVGIP NDMLASLASS VKAAEKWVY*                                     240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00332Glyco_hydro_173.0e-1413620873+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ghr_A0.0000003136208173A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB1aq0_B0.0000003136208173A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group
PDB1aq0_A0.0000003136208173A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group
PDB2cyg_A0.000004136208173A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB1ghs_B0.00004136208173A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
Hydropathy
Orthologous Group
SpeciesID
Arabidopsis lyrata899941
Carica papayaevm.model.supercontig_27.199
Glycine maxGlyma05g08020.2
Linum usitatissimumLus10020526
Malus domesticaMDP0000908326MDP0000233619MDP0000227501MDP0000631129MDP0000224162
Manihot esculentacassava4.1_024233m
Panicum virgatumPavirv00021846m
Picea abiesMA_17339g0010MA_8517491g0010MA_1055674g0010MA_6742g0010MA_8478g0010
MA_10437110g0010
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny