y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna27178.1-v1.0-hybrid
FamilyGT4
Protein PropertiesLength: 485 Molecular Weight: 54479.7 Isoelectric Point: 8.4425
ChromosomeChromosome/Scaffold: 3 Start: 23795506 End: 23796960
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT43014353.6e-21
  GVAGRLVKDKGHPLLYRAFSSIVKRYPGVFLLVAGSGPWRRRYAELGTNVKVLGALEPLQLSNFYNALDVFVNPTLRPQGLDLTLIEAMQSGKTVLTPNY
  PSIVGTVLVNEEFGYTFSPNVESFVEALELAIKDG
Full Sequence
Protein Sequence     Length: 485     Download
MGLKHQTCKS SSSSNFIRIR FSTILTLILL FTSLFLFLSS LKNTQEPFFG GDENTQFNGD    60
LRDAKFPWNK LFFGPTFEKL KLAVFSKTWP VGADPGGMER HASTLYQALA AKGHEVHVFT    120
VPSDKRPHWD IHEGNLHVYF AANDHGKVDC SLAFEIFNKV NSDGVFDYVH TESVALPYWR    180
AKRMPNVAVT WHGISYETMH SKLLQQLLTD PNGDMLEPMP ELQEALPKLI EEIRFFKNYK    240
QHICISKSAG EVLVNIYQIP QRNVHVILNG VDETEFLPDP EAGARFREKH GIPANVSLVM    300
GVAGRLVKDK GHPLLYRAFS SIVKRYPGVF LLVAGSGPWR RRYAELGTNV KVLGALEPLQ    360
LSNFYNALDV FVNPTLRPQG LDLTLIEAMQ SGKTVLTPNY PSIVGTVLVN EEFGYTFSPN    420
VESFVEALEL AIKDGPNVLK RKGVACKNYV HSVFTATKMA SAYERFFLCM KNPKYCQYPL    480
STDC*                                                                540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG0438RfaG3.0e-3181474411+
TIGR00032argG1.0e-3196465394+
cd03807GT1_WbnK_like3.0e-33243467234+
cd03798GT1_wlbH_like2.0e-3896467399+
cd03801GT1_YqgM_like2.0e-5981467400+
Gene Ontology
GO TermDescription
GO:0009058biosynthetic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3oka_B0.00000002269396170307A Chain A, Crystal Structure Of Corynebacterium Glutamicum Pimb' In Complex With Gdp-Man (Triclinic Crystal Form)
PDB3oka_A0.00000002269396170307A Chain A, Crystal Structure Of Corynebacterium Glutamicum Pimb' In Complex With Gdp-Man (Triclinic Crystal Form)
PDB3okp_A0.00000002269396170307A Chain A, Crystal Structure Of Corynebacterium Glutamicum Pimb' In Complex With Gdp-Man (Triclinic Crystal Form)
PDB3okc_A0.00000002269396170307A Chain A, Crystal Structure Of Corynebacterium Glutamicum Pimb' Bound To Gdp (Orthorhombic Crystal Form)
PDB2gek_A0.0000059539934314A Chain A, Crystal Structure Of Corynebacterium Glutamicum Pimb' Bound To Gdp (Orthorhombic Crystal Form)
Transmembrane Domains
StartEnd
2140
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_055_00071.1Aquca_004_00554.1
Arabidopsis lyrata316266919149492915
Arabidopsis thalianaAT1G73160.1AT5G59070.1AT4G19460.1
Brachypodium distachyonBradi2g45370.1
Brassica rapaBra012542Bra003857Bra013399Bra020331
Carica papayaevm.model.supercontig_305.3
Capsella rubellaCarubv10004612mCarubv10021524m
Citrus clementinaCiclev10008126mCiclev10003490m
Citrus sinensisorange1.1g039338morange1.1g044542m
Cucumis sativusCucsa.268510.1
Eucalyptus grandisEucgr.E01172.1Eucgr.F03250.1
Fragaria vescamrna27708.1-v1.0-hybrid
Glycine maxGlyma09g34990.1Glyma01g35440.1Glyma16g17250.1Glyma16g08210.1
Gossypium raimondiiGorai.009G372800.1Gorai.008G217900.1
Linum usitatissimumLus10032187Lus10014499Lus10033297Lus10034760
Malus domesticaMDP0000252217MDP0000510770MDP0000280727MDP0000690085
Manihot esculentacassava4.1_023608mcassava4.1_022788m
Medicago truncatulaMedtr5g026360.1Medtr8g071900.1
Mimulus guttatusmgv1a005617mmgv1a027119m
Oryza sativaLOC_Os01g46430.1
Panicum virgatumPavirv00039421mPavirv00050283m
Physcomitrella patensPp1s115_97V6.1Pp1s115_97V6.2Pp1s231_59V6.1
Phaseolus vulgarisPhvul.002G124600.1Phvul.003G277200.1
Picea abiesMA_159118g0690MA_58772g0010
Populus trichocarpaPotri.011G097000.1Potri.003G105500.1Potri.001G128300.1
Prunus persicappa004871mppa024212m
Ricinus communis30150.m00047029827.m002616
Setaria italicaSi001150m
Selaginella moellendorffii79637
Sorghum bicolorSb03g029770.1
Thellungiella halophilaThhalv10013459mThhalv10027268mThhalv10019571m
Vitis viniferaGSVIVT01036920001GSVIVT01036921001GSVIVT01036924001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny