y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna27242.1-v1.0-hybrid
FamilyGT22
Protein PropertiesLength: 571 Molecular Weight: 64380.8 Isoelectric Point: 8.9427
ChromosomeChromosome/Scaffold: 3 Start: 23962489 End: 23965914
DescriptionAlg9-like mannosyltransferase family
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT22504510
  LALGMLRYMSATSNIIHDCDEVFNYWEPLHYLLYKSGFQTWEYSSQFALRSYLYILFHELVARPASWWFGEEKVRVFYAVRMFLGLISVITETILVYALS
  RKYGKRLASYTLAMLCLTSGCFFASTSFLPSSFSMYAVSLSSGLFLLDKHAMAVSVAAAGVILGWPFSILVFLPVTIYSLARRFKLAFIAGAATSIVILA
  LSVLVDHSYYSRWTSSVLNLLVYNVAGGGESHLYGTEGPLFYLQNGFNNFNFCFVLALLFLVMLPIAKKKYSPDLLIVLSPIYIWLAFMSLQPHKEERFL
  YPIYPLICVAASAVIESFPDVFRSKYNPHDESALVMATKILRPVILSLILCASHARTFSLINGYSAPIEIYKLLEHHEDAGPGSVLCVGSEWHRFPSSFF
  VP
Full Sequence
Protein Sequence     Length: 571     Download
MALSTRQRRP QPSDPSSSSS PSVSYTKVDK QPKSGGVTAE KGFSWFVPLL ALGMLRYMSA    60
TSNIIHDCDE VFNYWEPLHY LLYKSGFQTW EYSSQFALRS YLYILFHELV ARPASWWFGE    120
EKVRVFYAVR MFLGLISVIT ETILVYALSR KYGKRLASYT LAMLCLTSGC FFASTSFLPS    180
SFSMYAVSLS SGLFLLDKHA MAVSVAAAGV ILGWPFSILV FLPVTIYSLA RRFKLAFIAG    240
AATSIVILAL SVLVDHSYYS RWTSSVLNLL VYNVAGGGES HLYGTEGPLF YLQNGFNNFN    300
FCFVLALLFL VMLPIAKKKY SPDLLIVLSP IYIWLAFMSL QPHKEERFLY PIYPLICVAA    360
SAVIESFPDV FRSKYNPHDE SALVMATKIL RPVILSLILC ASHARTFSLI NGYSAPIEIY    420
KLLEHHEDAG PGSVLCVGSE WHRFPSSFFV PDYVGEVRWI DDGFRGLLPF PFNSTLGGTA    480
AAPPYLNNKN KASDEQYLRD LEHCTFLVEL ELSRPFPSRG SDSSTWEVIA ALPYLDRELS    540
PAKYRSFFIP YVWMHKNIFG KYKLLRRVPK *                                   600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR04154archaeo_STT30.0002132359241+
PLN02816PLN028163.0e-669355302+
pfam03901Glyco_transf_225.0e-10048451431+
Gene Ontology
GO TermDescription
GO:0006506GPI anchor biosynthetic process
GO:0016757transferase activity, transferring glycosyl groups
GO:0031227intrinsic to endoplasmic reticulum membrane
Transmembrane Domains
StartEnd
4365
127149
156178
200222
235254
289311
324341
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_021_00239.3Aquca_021_00239.2Aquca_021_00239.1
Arabidopsis lyrata471892
Arabidopsis thalianaAT1G16900.1
Brachypodium distachyonBradi2g06627.1Bradi2g06627.2
Brassica rapaBra016625Bra026017
Carica papayaevm.model.supercontig_97.103
Capsella rubellaCarubv10008988mCarubv10008626m
Citrus clementinaCiclev10019496m
Citrus sinensisorange1.1g009200morange1.1g008307m
Cucumis sativusCucsa.057600.1
Eucalyptus grandisEucgr.F01228.1
Glycine maxGlyma13g34570.2Glyma12g35831.2Glyma12g35831.1Glyma13g34570.1
Gossypium raimondiiGorai.013G173400.1
Linum usitatissimumLus10028153Lus10042853
Malus domesticaMDP0000250399MDP0000193605
Manihot esculentacassava4.1_004544m
Medicago truncatulaMedtr2g076680.1
Mimulus guttatusmgv1a003735m
Oryza sativaLOC_Os01g11070.1
Panicum virgatumPavirv00044939m
Physcomitrella patensPp1s478_15V6.1
Phaseolus vulgarisPhvul.005G066500.1
Picea abiesMA_10429532g0010
Populus trichocarpaPotri.011G110800.1Potri.011G110800.2Potri.011G110800.3
Prunus persicappa003475m
Ricinus communis28842.m000906
Setaria italicaSi000820m
Selaginella moellendorffii442454
Sorghum bicolorSb03g002210.1
Thellungiella halophilaThhalv10007218m
Vitis viniferaGSVIVT01014208001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny