y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna27271.1-v1.0-hybrid
FamilyGT4
Protein PropertiesLength: 425 Molecular Weight: 47393.3 Isoelectric Point: 7.9766
ChromosomeChromosome/Scaffold: 3 Start: 24096842 End: 24099603
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT42143914.9e-40
  FLSINRFERKKNIDLAISAFAMLHTLEGDNLAEASLTIAGMLLLLFFSLTFSYMLIVLGGFDNRLRENVEYLEELKNLAEREGVSNQVKFITSCSTAERN
  ALLSQCLCVIYTPKDEHFGIVPLEAMAAHKPVIACNSGGPMETVKNGVTGFLCESNPREFSLAMAKLIQDPQMAQRMG
Full Sequence
Protein Sequence     Length: 425     Download
MAKRGGSSKL NVAIIHPDLG IGGAERLIVD AAVELASHGH KVHVFTSHHD KDRCFEETIS    60
GAFPVTVYGA FLPRHVFYHL HALCAYLRCL YVALCVLVMW PSFDVILVDQ VSVVIPLLKL    120
KKSAKVLFYC HFPDLLLAQH TTVLRRIYRK PIDFIEEMTT GMADKILVNS KFTALTFAKT    180
FKHLHARGIK PAVLYPAVNV NQFDEPSISH KLNFLSINRF ERKKNIDLAI SAFAMLHTLE    240
GDNLAEASLT IAGMLLLLFF SLTFSYMLIV LGGFDNRLRE NVEYLEELKN LAEREGVSNQ    300
VKFITSCSTA ERNALLSQCL CVIYTPKDEH FGIVPLEAMA AHKPVIACNS GGPMETVKNG    360
VTGFLCESNP REFSLAMAKL IQDPQMAQRM GVEARLHVTE SFSTKIFGQH LNQYLVDVAR    420
AKED*                                                                480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG0438RfaG1.0e-349422417+
cd03798GT1_wlbH_like3.0e-3610414426+
cd03811GT1_WabH_like6.0e-3811403407+
cd03801GT1_YqgM_like2.0e-4411403411+
cd03805GT1_ALG2_like010411414+
Gene Ontology
GO TermDescription
GO:0009058biosynthetic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2f9f_A0.00000000000000229938978168A Chain A, Crystal Structure Of The Putative Mannosyl Transferase (Wbaz-1)from Archaeoglobus Fulgidus, Northeast Structural Genomics Target Gr29a
PDB3c4v_B0.00000003289417276404A Chain A, Crystal Structure Of The Putative Mannosyl Transferase (Wbaz-1)from Archaeoglobus Fulgidus, Northeast Structural Genomics Target Gr29a
PDB3c4v_A0.00000003289417276404A Chain A, Crystal Structure Of The Putative Mannosyl Transferase (Wbaz-1)from Archaeoglobus Fulgidus, Northeast Structural Genomics Target Gr29a
PDB3c4q_B0.00000003289417276404A Chain A, Structure Of The Retaining Glycosyltransferase Msha : The First Step In Mycothiol Biosynthesis. Organism : Corynebacterium Glutamicum- Complex With Udp
PDB3c4q_A0.00000003289417276404A Chain A, Structure Of The Retaining Glycosyltransferase Msha : The First Step In Mycothiol Biosynthesis. Organism : Corynebacterium Glutamicum- Complex With Udp
Transmembrane Domains
StartEnd
252274
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_021_00182.1Aquca_021_00182.2Aquca_021_00182.3
Arabidopsis lyrata477043
Arabidopsis thalianaAT1G78800.1
Brachypodium distachyonBradi5g19840.1
Brassica rapaBra035064
Carica papayaevm.model.supercontig_77.17
Capsella rubellaCarubv10022022m
Chlamydomonas reinhardtiig1920.t1
Citrus clementinaCiclev10022599mCiclev10020399m
Citrus sinensisorange1.1g036860m
Cucumis sativusCucsa.220170.2Cucsa.273740.2Cucsa.273740.1Cucsa.220170.1
Eucalyptus grandisEucgr.F01245.1
Glycine maxGlyma12g35950.2Glyma12g35950.1Glyma13g34430.1Glyma13g34430.2
Gossypium raimondiiGorai.002G054000.2Gorai.002G054000.1
Linum usitatissimumLus10037008Lus10015797
Malus domesticaMDP0000319369MDP0000185482
Manihot esculentacassava4.1_008785m
Medicago truncatulaMedtr1g104880.1
Mimulus guttatusmgv1a007424m
Oryza sativaLOC_Os04g49960.1
Panicum virgatumPavirv00018845mPavirv00056995mPavirv00050038mPavirv00004378m
Physcomitrella patensPp1s246_77V6.1
Phaseolus vulgarisPhvul.005G081600.1
Picea abiesMA_499839g0010
Populus trichocarpaPotri.011G109000.1
Prunus persicappa006490mppa006502m
Ricinus communis29681.m001322
Setaria italicaSi017356mSi013830mSi010219m
Selaginella moellendorffii419620
Sorghum bicolorSb06g026860.1
Thellungiella halophilaThhalv10019736mThhalv10007837m
Vitis viniferaGSVIVT01014186001
Volvox carteriVocar20014584m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny