y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna27591.1-v1.0-hybrid
FamilyAA2
Protein PropertiesLength: 356 Molecular Weight: 38572.6 Isoelectric Point: 5.4144
ChromosomeChromosome/Scaffold: 2 Start: 1521220 End: 1523757
DescriptionPeroxidase superfamily protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2533170
  SIVRKQLKKVFKEDIGQAAGLLRLHFHDCFVQGCDGSVLLDGSASGPSEQQAPPNLSLRAKAFQIINDLREIVHSKCGRVVSCADLTALAARDAVFLSGG
  PEYEVPLGRKDGLNFATRNETLANLPAPTSNTTKLLTDLAKKNLDATDVVALSGGHTIGLGHCTSFTGRLYPTQDASMDKTFANDLKQVCPAADTNATTV
  LDIRSPDTFDNKYYVDLMNRQGLFTSDQDLYTDKRTRDIVTSFAVNQTLFFEKFVHSMIKMGQLS
Full Sequence
Protein Sequence     Length: 356     Download
MASTFASLCS LLLIVSSVLV SSYFGVSEAQ PSVPVVKGLS WSFYDSSCPK LDSIVRKQLK    60
KVFKEDIGQA AGLLRLHFHD CFVQGCDGSV LLDGSASGPS EQQAPPNLSL RAKAFQIIND    120
LREIVHSKCG RVVSCADLTA LAARDAVFLS GGPEYEVPLG RKDGLNFATR NETLANLPAP    180
TSNTTKLLTD LAKKNLDATD VVALSGGHTI GLGHCTSFTG RLYPTQDASM DKTFANDLKQ    240
VCPAADTNAT TVLDIRSPDT FDNKYYVDLM NRQGLFTSDQ DLYTDKRTRD IVTSFAVNQT    300
LFFEKFVHSM IKMGQLSVLT GSKGEIRANC SMRNSDNANY LSSVVEEDEE SLSEF*        360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00691ascorbate_peroxidase6.0e-1355318279+
cd00314plant_peroxidase_like1.0e-2853315291+
pfam00141peroxidase6.0e-6055212158+
PLN03030PLN030303.0e-7337334310+
cd00693secretory_peroxidase3.0e-16138331300+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1bgp_A0293341305A Chain A, Crystal Structure Of Barley Grain Peroxidase 1
PDB3hdl_A0393352304A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree
PDB1qgj_B0393352300A Chain A, Arabidopsis Thaliana Peroxidase N
PDB1qgj_A0393352300A Chain A, Arabidopsis Thaliana Peroxidase N
PDB1qo4_A0393343304A Chain A, Arabidopsis Thaliana Peroxidase N
Transmembrane Domains
StartEnd
527
Signal Peptide
Cleavage Site
29
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_114_00002.1Aquca_023_00176.2Aquca_023_00176.1Aquca_023_00171.1Aquca_023_00181.1
Aquca_023_00178.1Aquca_023_00180.1Aquca_023_00179.1
Arabidopsis lyrata895007
Arabidopsis thalianaAT1G71695.1
Brachypodium distachyonBradi3g13590.1Bradi3g33940.1Bradi2g09600.1Bradi4g27680.1Bradi5g27130.1
Bradi5g27150.1Bradi2g17120.1Bradi5g27220.1Bradi5g27210.1Bradi5g27200.1
Bradi5g27170.1Bradi5g27160.1
Brassica rapaBra003918Bra016127
Carica papayaevm.model.supercontig_49.84
Capsella rubellaCarubv10020541m
Citrus clementinaCiclev10001726m
Citrus sinensisorange1.1g019278m
Eucalyptus grandisEucgr.I00020.1Eucgr.F04198.1Eucgr.F04195.1Eucgr.L02740.1Eucgr.J02563.1
Glycine maxGlyma16g27890.1Glyma10g36680.1Glyma20g30910.1Glyma16g27880.1Glyma16g27900.1
Glyma10g36690.1Glyma16g27900.3
Gossypium raimondiiGorai.010G131800.1Gorai.005G077600.1
Linum usitatissimumLus10028735Lus10028689
Malus domesticaMDP0000176436.181.349MDP0000176436.181.349MDP0000642832
Manihot esculentacassava4.1_025536mcassava4.1_010796mcassava4.1_025889mcassava4.1_032882mcassava4.1_031254m
cassava4.1_010776mcassava4.1_027775mcassava4.1_013268mcassava4.1_021820m
Medicago truncatulaMedtr1g106870.1
Mimulus guttatusmgv1a009174m
Oryza sativaLOC_Os08g02110.1LOC_Os01g73220.1LOC_Os01g73170.1LOC_Os01g73200.1LOC_Os04g59150.1
LOC_Os01g73190.1LOC_Os04g59160.1LOC_Os04g59200.1LOC_Os04g59210.1LOC_Os04g59260.1
LOC_Os04g59190.1LOC_Os04g59150.2
Panicum virgatumPavirv00006034mPavirv00009935mPavirv00047812mPavirv00054325mPavirv00068704m
Pavirv00024512mPavirv00006543mPavirv00052301mPavirv00016398mPavirv00020256m
Pavirv00002644m
Phaseolus vulgarisPhvul.007G082600.1Phvul.007G082700.1Phvul.004G090800.1
Picea abiesMA_62726g0010MA_10427332g0010MA_10432033g0020MA_10275776g0010MA_66200g0010
MA_497337g0010MA_57932g0010MA_13490g0020MA_8813326g0010MA_10430613g0010.304.542
MA_10430613g0010.304.542MA_10432865g0020MA_10115394g0010MA_73034g0010MA_1125g0010.202.340
MA_1125g0010.202.340MA_170633g0010MA_466251g0010
Populus trichocarpaPotri.005G195600.1Potri.002G065300.1Potri.005G195700.1
Prunus persicappa007748m
Ricinus communis28644.m00090129863.m00107629863.m001072
Setaria italicaSi001960mSi002014mSi022514mSi002007mSi022669m
Si022524mSi022622m
Selaginella moellendorffii177321230656
Sorghum bicolorSb06g033840.1Sb03g046810.1Sb03g046760.1Sb06g033870.1Sb06g033850.1
Sb06g033860.1
Thellungiella halophilaThhalv10018753mThhalv10018936m
Vitis viniferaGSVIVT01034574001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)