y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna27708.1-v1.0-hybrid
FamilyGT4
Protein PropertiesLength: 491 Molecular Weight: 55085.3 Isoelectric Point: 8.736
ChromosomeChromosome/Scaffold: 5 Start: 13866921 End: 13868393
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT43104511.2e-24
  VFGVAGRLVKDKGHPILYEAFSELIAKHQNVYLIVAGSGPWEQRYKDLGPRVLVLGSMSPSELHAFYNAIDVFVNPTLRPQGLDLTLMEAMMSGKPVMAS
  RFPSIKGSIVVDDEFGFMFAPNVASLLEALELAVKEGSRRMS
Full Sequence
Protein Sequence     Length: 491     Download
MASFIKPKKP MSSSQSNLCT TLFFIVLFTI PVLFLLHTST TSSIICTSHF NNNPPFSGDL    60
RAAEFSWNRL SFLQHRPNPP ASLKIAVFSR KWPIATTPGG MERHAHTLHT ALSLLGHQVH    120
VFTSPVKPQK LMSQNRLNLS PSSSPPYLHF HEGDPGYWRY NKAYEQFLEE DEKQKFDVVH    180
SESVALPHWL ARRIPNLAVS WHGIALESLH SNIFQDLTRK QGEPIEPAFN QSLQGVVPKV    240
LNEIRFFHNY AHHVAISDSC GEMLRDVYQI PNKRVHVILN GVNEEDFGVD SKLGEEFRGG    300
IGIPQNASMV FGVAGRLVKD KGHPILYEAF SELIAKHQNV YLIVAGSGPW EQRYKDLGPR    360
VLVLGSMSPS ELHAFYNAID VFVNPTLRPQ GLDLTLMEAM MSGKPVMASR FPSIKGSIVV    420
DDEFGFMFAP NVASLLEALE LAVKEGSRRM SQRGKACREY ASSMFTARKM ALAYERLFLC    480
IKNDTFCNYP *                                                         540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd03811GT1_WabH_like9.0e-3099431345+
cd03807GT1_WbnK_like2.0e-3098478399+
TIGR00032argG3.0e-31245477241+
cd03798GT1_wlbH_like1.0e-36157477336+
cd03801GT1_YqgM_like3.0e-5484478407+
Gene Ontology
GO TermDescription
GO:0009058biosynthetic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3c4v_B0.000000029944622379A Chain A, Crystal Structure Of Guanylate Kinase From Mycobacterium Tuberculosis (Rv1389)
PDB3c4v_A0.000000029944622379A Chain A, Crystal Structure Of Guanylate Kinase From Mycobacterium Tuberculosis (Rv1389)
PDB3c4q_B0.000000029944622379A Chain A, Structure Of The Retaining Glycosyltransferase Msha : The First Step In Mycothiol Biosynthesis. Organism : Corynebacterium Glutamicum- Complex With Udp
PDB3c4q_A0.000000029944622379A Chain A, Structure Of The Retaining Glycosyltransferase Msha : The First Step In Mycothiol Biosynthesis. Organism : Corynebacterium Glutamicum- Complex With Udp
PDB3c48_B0.000000039944642399A Chain A, Structure Of The Retaining Glycosyltransferase Msha: The First Step In Mycothiol Biosynthesis. Organism: Corynebacterium Glutamicum- Apo (Open) Structure.
Transmembrane Domains
StartEnd
1335
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_055_00071.1Aquca_004_00554.1
Arabidopsis lyrata316266919149492915
Arabidopsis thalianaAT1G73160.1AT5G59070.1AT4G19460.1
Brachypodium distachyonBradi2g45370.1
Brassica rapaBra012542Bra003857Bra013399Bra020331
Carica papayaevm.model.supercontig_305.3
Capsella rubellaCarubv10004612mCarubv10021524m
Citrus clementinaCiclev10008126mCiclev10003490m
Citrus sinensisorange1.1g039338morange1.1g044542m
Cucumis sativusCucsa.268510.1
Eucalyptus grandisEucgr.E01172.1Eucgr.F03250.1
Fragaria vescamrna27178.1-v1.0-hybrid
Glycine maxGlyma09g34990.1Glyma01g35440.1Glyma16g17250.1Glyma16g08210.1
Gossypium raimondiiGorai.009G372800.1Gorai.008G217900.1
Linum usitatissimumLus10032187Lus10014499Lus10033297Lus10034760
Malus domesticaMDP0000252217MDP0000510770MDP0000280727MDP0000690085
Manihot esculentacassava4.1_023608mcassava4.1_022788m
Medicago truncatulaMedtr5g026360.1Medtr8g071900.1
Mimulus guttatusmgv1a005617mmgv1a027119m
Oryza sativaLOC_Os01g46430.1
Panicum virgatumPavirv00039421mPavirv00050283m
Physcomitrella patensPp1s115_97V6.1Pp1s115_97V6.2Pp1s231_59V6.1
Phaseolus vulgarisPhvul.002G124600.1Phvul.003G277200.1
Picea abiesMA_159118g0690MA_58772g0010
Populus trichocarpaPotri.011G097000.1Potri.003G105500.1Potri.001G128300.1
Prunus persicappa004871mppa024212m
Ricinus communis30150.m00047029827.m002616
Setaria italicaSi001150m
Selaginella moellendorffii79637
Sorghum bicolorSb03g029770.1
Thellungiella halophilaThhalv10013459mThhalv10027268mThhalv10019571m
Vitis viniferaGSVIVT01036920001GSVIVT01036921001GSVIVT01036924001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny