y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna27855.1-v1.0-hybrid
FamilyGH13
Protein PropertiesLength: 869 Molecular Weight: 96831.4 Isoelectric Point: 5.0767
ChromosomeChromosome/Scaffold: 2 Start: 15104799 End: 15107405
Descriptiondebranching enzyme 1
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH133757041.8e-32
  TNVAGTFSGLTQKLDHFQDLGVNAILLEPIFPFDEEKGPYFPCHFFSPMNCFGPSGGPIASINSMKEMVKEFHANGIEVILEVIFTHTAEGEVLQGIDIS
  SYYHASTTGDLEAGNSLNCNHPVVQQMVLDSLRYWVTEFHIDGFCFINASSLLHGVKGEYQSRPPLVEAITFDPLLAKTKFIADCWDPHEMVPKETRFPH
  WKRWAEVNTRFCNDVRNFLRGEGLLSDLATRLCGNGDIFSDGRGPAFSFNFITRNSGLPLVDLVSFSGSELASELSWNCGEEGPTSKTAVLERRLKQIRN
  FLFILYLSLGVPVLNMGDECGQSSGGSPAY
Full Sequence
Protein Sequence     Length: 869     Download
MALSITPQAC CWACGTTSES SKLTANTHYR DRKKTTLGLV KLDAERKLVF GGFGQSFAQS    60
SLRGCHSRVQ AASGVSIEPM EQNFPTGTEE TNKVSTYLFR TENGDLINVF VRDNTVNYSV    120
YVELSSLQLS SAGDRLVISW GMYRADSSSL KPLDFIETPF TKTSSGSFTL ELEFEAKQTP    180
FYLSFTVKSL ADANLSGLEI RSHRKTNFCV PVGFGRGCPT PLGLSYSSDG SINFAIFSRN    240
AESVVLCLYD DPTAQEPALE LDLDPYVNRS GDIWHASFES AWTFLSYGYR FKGTSLRNTN    300
SLDEGNVLLD PYAKVIDESI ANNRGTGLKL LGRLCEEPVF DWDGDVRPLL PIEKLVVYRL    360
NLKRFTEHKS SKLPTNVAGT FSGLTQKLDH FQDLGVNAIL LEPIFPFDEE KGPYFPCHFF    420
SPMNCFGPSG GPIASINSMK EMVKEFHANG IEVILEVIFT HTAEGEVLQG IDISSYYHAS    480
TTGDLEAGNS LNCNHPVVQQ MVLDSLRYWV TEFHIDGFCF INASSLLHGV KGEYQSRPPL    540
VEAITFDPLL AKTKFIADCW DPHEMVPKET RFPHWKRWAE VNTRFCNDVR NFLRGEGLLS    600
DLATRLCGNG DIFSDGRGPA FSFNFITRNS GLPLVDLVSF SGSELASELS WNCGEEGPTS    660
KTAVLERRLK QIRNFLFILY LSLGVPVLNM GDECGQSSGG SPAYSDRKSF DWKALETGFA    720
TQITQFIAYL SSLRRRRSDL LQKKHFFKEE NIDWYGSDQS LPRWEDPLCK FLAVRLKADQ    780
DEVENQSNSV YAGLRGDLFL AFSAADQSET VILPPPQEGM AWSRLVDTAL PFPGFFSTDG    840
EPVIEQMKDL CAYEMKSHSC ALFEARSL*                                      900
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK03705PRK037052.0e-81217728583+
COG1523PulA5.0e-109219831682+
cd11326AmyAc_Glg_debranch2.0e-119340700400+
TIGR02100glgX_debranch1.0e-119217833703+
cd11346AmyAc_plant_IsoA2.0e-130351728390+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0043169cation binding
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vuy_B021774715606A Chain A, X-Ray Crystal Structure Of Tdp-Vancosaminyltransferase Gtfd As A Complex With Tdp And The Natural Substrate, Desvancosaminyl Vancomycin.
PDB2vuy_A021774715606A Chain A, X-Ray Crystal Structure Of Tdp-Vancosaminyltransferase Gtfd As A Complex With Tdp And The Natural Substrate, Desvancosaminyl Vancomycin.
PDB2vr5_B021774715606A Chain A, X-Ray Crystal Structure Of Tdp-Vancosaminyltransferase Gtfd As A Complex With Tdp And The Natural Substrate, Desvancosaminyl Vancomycin.
PDB2vr5_A021774715606A Chain A, X-Ray Crystal Structure Of Tdp-Vancosaminyltransferase Gtfd As A Complex With Tdp And The Natural Substrate, Desvancosaminyl Vancomycin.
PDB2vnc_B021774715606A Chain A, Crystal Structure Of Glycogen Debranching Enzyme Trex From Sulfolobus Solfataricus
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00091.4Aquca_014_00091.1Aquca_014_00091.3Aquca_014_00091.2Aquca_014_00091.5
Aquca_014_00091.6Aquca_014_00091.7Aquca_018_00158.1Aquca_018_00158.2Aquca_014_00091.8
Aquca_026_00010.1
Arabidopsis lyrata911044483030470308
Arabidopsis thalianaAT4G09020.1AT2G39930.1AT1G03310.2AT1G03310.1
Brachypodium distachyonBradi4g32707.2Bradi4g32707.1Bradi3g40410.2Bradi3g40410.1Bradi2g26170.1
Brassica rapaBra000667Bra005001Bra030528Bra033388
Carica papayaevm.model.supercontig_36.185evm.model.supercontig_485.4evm.model.supercontig_115.45
Capsella rubellaCarubv10003443mCarubv10024947mCarubv10012076m
Chlamydomonas reinhardtiig4436.t1g3160.t1
Citrus clementinaCiclev10000452mCiclev10000347mCiclev10007489mCiclev10023436m
Citrus sinensisorange1.1g009902morange1.1g006791morange1.1g003977morange1.1g011993morange1.1g005976m
orange1.1g003653morange1.1g003901morange1.1g005552morange1.1g047308m
Cucumis sativusCucsa.311690.1Cucsa.281840.2Cucsa.281840.1Cucsa.084930.1
Eucalyptus grandisEucgr.B00043.1Eucgr.C02189.3Eucgr.C02189.2Eucgr.C02189.1Eucgr.K03392.1
Fragaria vescamrna11912.1-v1.0-hybridmrna12022.1-v1.0-hybrid
Glycine maxGlyma06g10540.2Glyma04g10693.3Glyma04g10693.2Glyma04g10693.1Glyma08g03210.2
Glyma08g03210.1Glyma03g30771.1Glyma19g33620.2
Gossypium raimondiiGorai.009G233800.1Gorai.009G233800.2Gorai.009G233800.3Gorai.012G008800.3Gorai.012G008800.2
Gorai.012G008800.1Gorai.007G134600.3Gorai.007G134600.2Gorai.007G134600.1
Linum usitatissimumLus10036474Lus10021586Lus10000661Lus10027999Lus10017150
Malus domesticaMDP0000119748MDP0000118987MDP0000313388MDP0000185233MDP0000647541
MDP0000258604MDP0000238431
Manihot esculentacassava4.1_001932mcassava4.1_001414m
Medicago truncatulaMedtr3g099500.1Medtr8g101490.1
Mimulus guttatusmgv1a002417mmgv1a001549mmgv1a001869m
Oryza sativaLOC_Os08g40930.1LOC_Os09g29404.3LOC_Os09g29404.1LOC_Os05g32710.1
Panicum virgatumPavirv00034683mPavirv00034682mPavirv00063957mPavirv00032505mPavirv00012813m
Physcomitrella patensPp1s25_63V6.1Pp1s36_254V6.2Pp1s36_254V6.1Pp1s62_201V6.2
Phaseolus vulgarisPhvul.009G033200.1Phvul.002G303600.1Phvul.001G148700.1Phvul.005G040300.1
Picea abiesMA_10431226g0020MA_159157g0180
Populus trichocarpaPotri.002G100900.2Potri.002G100900.4Potri.002G100900.3Potri.002G100900.1Potri.006G070800.3
Potri.006G070800.2Potri.006G070800.1Potri.018G132500.4Potri.018G132500.3Potri.018G132500.2
Potri.018G132500.1Potri.018G132500.5Potri.002G215400.1Potri.002G219900.1
Prunus persicappa001639mppa025097mppa001199m
Ricinus communis29908.m00608929776.m00048828153.m00028728323.m00004135877.m000015
27724.m00001829104.m000024
Setaria italicaSi029005mSi013277m
Selaginella moellendorffii10621875877414611
Sorghum bicolorSb02g027280.3Sb02g027280.2Sb02g027280.1Sb07g027200.1Sb09g019480.1
Thellungiella halophilaThhalv10028487mThhalv10028455mThhalv10028452mThhalv10016275mThhalv10006762m
Vitis viniferaGSVIVT01009087001GSVIVT01035168001GSVIVT01011096001
Volvox carteriVocar20007238mVocar20007651m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)