y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna28030.1-v1.0-hybrid
FamilyCE10
Protein PropertiesLength: 477 Molecular Weight: 52388 Isoelectric Point: 8.4448
ChromosomeChromosome/Scaffold: 6 Start: 37602930 End: 37605695
Descriptionalpha/beta-Hydrolases superfamily protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE101624510
  RGYSPANSAKKSRKLPVILQFHGGGWVSGSNDSVANDCFCRRIAKLCDVIVVAVGYRLAPENRYPAAFEDGLKVLNWLGKQANLANLSMGGATELKKTDN
  RHIVDTFGASMVEPWLAAHGDPSRCVLLGVSCGANIADYVARKAVEAGKLLEPVKVVAQVLMYPFFVGSVPTHSEIKLANSYFYDKAMCMLAWKLFLPEE
  EFSLDHPAANPLIPDRQPPLKLMPPTLTVVAEHDWMRDRAIAYSEELRKVNVDAPVMEYKDAVHEFATLDMLLKTPQAQACAEDIAIWKL
Full Sequence
Protein Sequence     Length: 477     Download
MPSVAVKLYS VFFKFLLKHR LQNRIQTRPD DFDPFGVTSR PEETIAAANP LFDDDGVATK    60
DIHIDPFTSL SIRIFLPESA LSPPEPSVKS RPRRPDLNSP SVSDSARPSP NGSPFHSSRR    120
NSYGNAAAAN TLKAEPRRSS YGFSNDVEGL NLMAGVGAGV YRGYSPANSA KKSRKLPVIL    180
QFHGGGWVSG SNDSVANDCF CRRIAKLCDV IVVAVGYRLA PENRYPAAFE DGLKVLNWLG    240
KQANLANLSM GGATELKKTD NRHIVDTFGA SMVEPWLAAH GDPSRCVLLG VSCGANIADY    300
VARKAVEAGK LLEPVKVVAQ VLMYPFFVGS VPTHSEIKLA NSYFYDKAMC MLAWKLFLPE    360
EEFSLDHPAA NPLIPDRQPP LKLMPPTLTV VAEHDWMRDR AIAYSEELRK VNVDAPVMEY    420
KDAVHEFATL DMLLKTPQAQ ACAEDIAIWK LSKENSSLLL LPGAYTAKSF RWPLPR*       480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00135COesterase1.0e-6164300152+
cd00312Esterase_lipase6.0e-7164295141+
PRK10162PRK101624.0e-716225296+
COG0657Aes2.0e-34161447287+
pfam07859Abhydrolase_33.0e-62179428250+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016787hydrolase activity
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2zsi_A2e-33176430113331A Chain A, Structure Of Fructose-Bisphosphate Aldolase
PDB2zsh_A2e-33176430113331B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB3ed1_F3e-31176430112330B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB3ed1_E3e-31176430112330B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB3ed1_D3e-31176430112330B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_011_00310.1Aquca_123_00012.1
Arabidopsis lyrata484517488268
Arabidopsis thalianaAT5G14310.1AT3G27320.2AT3G27320.1
Brachypodium distachyonBradi2g57920.1Bradi4g39410.1
Brassica rapaBra006247Bra032997Bra008767
Carica papayaevm.model.supercontig_130.43evm.model.supercontig_130.44
Capsella rubellaCarubv10017202mCarubv10000956m
Citrus clementinaCiclev10031742mCiclev10015160m
Citrus sinensisorange1.1g015994morange1.1g012432m
Cucumis sativusCucsa.156360.1
Eucalyptus grandisEucgr.B03228.1Eucgr.I01696.1
Glycine maxGlyma19g24390.1Glyma16g06780.1Glyma05g06430.1Glyma19g22760.1
Gossypium raimondiiGorai.006G038400.1Gorai.007G074300.2Gorai.012G091000.1Gorai.002G190500.1Gorai.001G268100.1
Gorai.011G093200.1Gorai.007G074300.1
Linum usitatissimumLus10037056Lus10036931Lus10022326
Malus domesticaMDP0000464809MDP0000303241MDP0000479020MDP0000251187
Manihot esculentacassava4.1_006786mcassava4.1_009359m
Mimulus guttatusmgv1a026769mmgv1a021886mmgv1a005804m
Oryza sativaLOC_Os12g15400.1LOC_Os01g67600.1
Panicum virgatumPavirv00029958mPavirv00024043mPavirv00043387m
Physcomitrella patensPp1s540_9V6.1
Phaseolus vulgarisPhvul.004G057500.1Phvul.008G149400.1
Picea abiesMA_19054g0010MA_10435834g0010
Populus trichocarpaPotri.008G180500.1Potri.008G180600.1Potri.T111700.1Potri.010G053700.1
Prunus persicappa025969mppa005102m
Ricinus communis29633.m00088529929.m004742
Selaginella moellendorffii123940
Sorghum bicolorSb03g042970.1
Thellungiella halophilaThhalv10013549m
Vitis viniferaGSVIVT01003964001GSVIVT01010303001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny