y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna28048.1-v1.0-hybrid
FamilyCBM57
Protein PropertiesLength: 494 Molecular Weight: 54445.5 Isoelectric Point: 4.6005
ChromosomeChromosome/Scaffold: 3 Start: 19779935 End: 19788939
DescriptionLeucine-rich repeat transmembrane protein kinase
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM57422024.5e-24
  MINCGGPQTKISNGTVYEQDSEPLGTATYYVTETNRWGVSNVGLKTQLTARISASSLRYYGLGLENGNYTVKLEFAEQAILDESTRKSHGRRVFDIYIQD
  VLVAKDFDIRNETNRTSLVAIEMVYNAQVVSENYLEIHFFWAGKGTCCIPEEGTYGPLISA
Full Sequence
Protein Sequence     Length: 494     Download
MECFLAAAVV LDLKNGGLPS GLNCLQRGFP CHRDSPVYYN FMINCGGPQT KISNGTVYEQ    60
DSEPLGTATY YVTETNRWGV SNVGLKTQLT ARISASSLRY YGLGLENGNY TVKLEFAEQA    120
ILDESTRKSH GRRVFDIYIQ DVLVAKDFDI RNETNRTSLV AIEMVYNAQV VSENYLEIHF    180
FWAGKGTCCI PEEGTYGPLI SAISATPEFK PTVSNKLPST KKNRTGMIVG IVVSGGVLIL    240
LVLLFYIVQI RKRHNSDDDY DEAACSIFIS GFDVQAQPTT DPSEVRALNA IFQKWNITNK    300
VKQWNTTGDP CSGIAIDEDD DTSYFYDATN YNPKASILDI VAPIPEELYT LTFLQYLDVK    360
KNYLTGPISA SIGNLSSVTY LNLGHNDLSG EFPKDIVKLN NLTYLNLGHN DLSGELPKDI    420
VKLNNLTYLA LGTLDLSGSL PPEIGFIDNS GLSGEIPPTF ANLTNLEQFW ATDTNLTGRL    480
PDFVGNWTKL TTL*                                                      540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN00113PLN001135.0e-23343493159+
PLN00113PLN001134.0e-23344490158+
PLN00113PLN001133.0e-24340493163+
PLN00113PLN001135.0e-25344484149+
pfam11721Malectin1.0e-5239203170+
Gene Ontology
GO TermDescription
GO:0005515protein binding
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ogq_A5e-162814634197A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense
PDB1ogq_A0.00244449383130A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense
PDB3rgz_A0.00000000002354454634742A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense
PDB3rgz_A0.00000000007332493391543A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense
Transmembrane Domains
StartEnd
226248
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_030_00368.2Aquca_030_00368.1
Arabidopsis lyrata883240.424.594883240.424.594892639892640892638
Arabidopsis thalianaAT1G56130.1AT1G56140.1AT1G56120.1AT1G56145.2AT1G56145.1
Brachypodium distachyonBradi5g21870.2Bradi5g21857.1Bradi3g17756.2Bradi3g17756.1Bradi1g48230.1
Brassica rapaBra003333Bra007909Bra007908Bra030813Bra030815
Bra033670Bra035966Bra033958Bra007907Bra016226
Carica papayaevm.model.supercontig_2207.1evm.model.supercontig_748.4
Capsella rubellaCarubv10008172mCarubv10012587mCarubv10010895mCarubv10008256mCarubv10008071m.409.563
Carubv10008071m.409.563Carubv10008183m
Citrus clementinaCiclev10007054mCiclev10007687mCiclev10007686mCiclev10018029mCiclev10018038m
Ciclev10014641mCiclev10014117m
Citrus sinensisorange1.1g001658morange1.1g008072morange1.1g006515morange1.1g006206morange1.1g004413m
orange1.1g002562morange1.1g002581morange1.1g038019m
Cucumis sativusCucsa.239700.2Cucsa.239700.1
Eucalyptus grandisEucgr.F04434.2Eucgr.F04434.1Eucgr.F04306.1Eucgr.F04441.1Eucgr.F02391.1
Eucgr.F04436.1Eucgr.C02767.1Eucgr.L01594.1Eucgr.F04301.1Eucgr.L01787.1
Eucgr.B01468.1Eucgr.F04437.1
Fragaria vescamrna11624.1-v1.0-hybridmrna16334.1-v1.0-hybridmrna30033.1-v1.0-hybrid
Glycine maxGlyma09g15200.3Glyma09g15200.2Glyma09g15200.1Glyma08g25590.2Glyma08g25600.2
Glyma08g25600.1
Gossypium raimondiiGorai.002G105800.1Gorai.001G034000.1Gorai.011G052100.1Gorai.N011200.1Gorai.011G052400.2
Gorai.011G052400.1Gorai.001G131900.1Gorai.006G091400.1Gorai.011G052300.5Gorai.011G052300.4
Gorai.011G052300.3Gorai.011G052300.2Gorai.011G052300.1Gorai.011G052000.1Gorai.011G052600.8
Gorai.011G052600.7Gorai.011G052600.6Gorai.011G052600.5Gorai.011G052600.4Gorai.011G052600.3
Gorai.011G052600.2Gorai.011G052600.1
Linum usitatissimumLus10031199
Malus domesticaMDP0000210289MDP0000183693.203.372MDP0000183693.203.372MDP0000213902MDP0000251746
MDP0000269684MDP0000267728MDP0000281046MDP0000207688MDP0000183693.772.939
MDP0000183693.772.939MDP0000389758MDP0000278907MDP0000306337MDP0000384033
MDP0000171164MDP0000307776MDP0000212717MDP0000311945MDP0000308237
MDP0000283397MDP0000122720
Manihot esculentacassava4.1_001509mcassava4.1_001407mcassava4.1_025733mcassava4.1_030674m
Mimulus guttatusmgv1a002601mmgv1a018669mmgv1a000612m
Oryza sativaLOC_Os04g22470.1LOC_Os08g10300.1LOC_Os08g10290.1LOC_Os04g52640.3LOC_Os04g52640.2
LOC_Os04g52640.1LOC_Os04g52600.1LOC_Os04g52630.1LOC_Os05g17810.1LOC_Os04g52614.1
LOC_Os08g10330.1LOC_Os05g17604.6LOC_Os05g17604.5LOC_Os05g17604.4LOC_Os05g17604.3
LOC_Os05g17604.2LOC_Os05g17604.1LOC_Os05g16430.1LOC_Os08g10320.3LOC_Os08g10320.2
LOC_Os08g10320.1LOC_Os08g10310.3LOC_Os08g10310.2LOC_Os08g10310.1LOC_Os04g52606.1
LOC_Os05g16930.1LOC_Os06g07130.1LOC_Os04g52590.1LOC_Os08g10250.1LOC_Os05g16824.4
LOC_Os05g16824.3LOC_Os05g16824.2LOC_Os05g16824.1LOC_Os05g16740.1
Panicum virgatumPavirv00010367mPavirv00021132mPavirv00063388mPavirv00039446mPavirv00006527m
Pavirv00041471mPavirv00039639mPavirv00031150mPavirv00014784mPavirv00036213m
Pavirv00070332mPavirv00032467mPavirv00022623mPavirv00048042m
Physcomitrella patensPp1s244_27V6.2
Phaseolus vulgarisPhvul.011G169300.1
Picea abiesMA_170647g0010MA_162469g0010MA_73800g0010MA_8849269g0010MA_18275g0010
MA_17053g0010MA_954053g0010MA_54077g0010MA_10436782g0010MA_404302g0010
MA_461914g0010
Populus trichocarpaPotri.006G255100.2Potri.018G026800.2Potri.018G026800.1Potri.006G255100.1Potri.001G082900.5
Potri.001G082900.4Potri.001G082900.3Potri.001G082900.2Potri.001G082900.1Potri.003G148000.3
Potri.003G148000.2Potri.003G148000.1Potri.007G067900.3Potri.007G067900.2Potri.007G067900.1
Prunus persicappa017326mppa017049mppa001211mppa001152mppa000802m
ppa015982mppa026535m
Ricinus communis29848.m00461730169.m00632829497.m00008929624.m000325
Setaria italicaSi013203mSi013191mSi013178mSi009240mSi012655m
Si009468mSi009463mSi009322mSi028769mSi028790m
Si009325mSi009466mSi009259mSi006097m
Selaginella moellendorffii438852
Sorghum bicolorSb07g005820.1Sb06g028570.1Sb06g028560.1Sb10g004730.1
Thellungiella halophilaThhalv10012006mThhalv10018064mThhalv10011215mThhalv10016280mThhalv10016175m
Thhalv10019658mThhalv10012222m
Vitis viniferaGSVIVT01037993001.434.602GSVIVT01037993001.434.602GSVIVT01035865001GSVIVT01013621001GSVIVT01029720001.503.674
GSVIVT01029720001.503.674GSVIVT01037982001GSVIVT01038011001GSVIVT01013608001GSVIVT01013612001
GSVIVT01029718001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)