y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna28143.1-v1.0-hybrid
FamilyAA2
Protein PropertiesLength: 325 Molecular Weight: 35602 Isoelectric Point: 10.415
ChromosomeChromosome/Scaffold: 3 Start: 20350733 End: 20352048
DescriptionPeroxidase superfamily protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2543040
  REPRIGASLLRLHFHDCFVNGCDGSILLDDAAKFTGEKTALPNANSVRGFNVIDDIKKAVNKACKRNVVSCADILAVAARDSVNILQGPQYKVLLGRRDA
  RNASLNDANRNLPPPFFSFAQLLSNFQSHGLNLKDLVVLSAAHTIGQARCTTFKQRIYNDTNIDPKFAAFAKKNCPSSGGDDKIEPLDATPRRFDTVYFK
  SLLKNKGLLHSDQELFKGNGSASDKLVHHYSSHSSAFGKDFSKSMIKMGNM
Full Sequence
Protein Sequence     Length: 325     Download
MAALRFSALL FFIAFVATTS LIPTSAKLTA NFYNKVCPQA LPTIRRVVKQ AIHREPRIGA    60
SLLRLHFHDC FVNGCDGSIL LDDAAKFTGE KTALPNANSV RGFNVIDDIK KAVNKACKRN    120
VVSCADILAV AARDSVNILQ GPQYKVLLGR RDARNASLND ANRNLPPPFF SFAQLLSNFQ    180
SHGLNLKDLV VLSAAHTIGQ ARCTTFKQRI YNDTNIDPKF AAFAKKNCPS SGGDDKIEPL    240
DATPRRFDTV YFKSLLKNKG LLHSDQELFK GNGSASDKLV HHYSSHSSAF GKDFSKSMIK    300
MGNMKPLTGT AGEVRLNCRK INNQ*                                          360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00314plant_peroxidase_like7.0e-2843303290+
pfam00141peroxidase1.0e-6344198155+
PLN03030PLN030306.0e-725322331+
cd00693secretory_peroxidase2.0e-15227321303+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1sch_B0273221294A Chain A, Peanut Peroxidase
PDB1sch_A0273221294A Chain A, Peanut Peroxidase
PDB1qo4_A0273222304A Chain A, Peanut Peroxidase
PDB1pa2_A0273222304A Chain A, Arabidopsis Thaliana Peroxidase A2
PDB4a5g_B0263222305A Chain A, Raphanus Sativus Anionic Peroxidase.
Transmembrane Domains
StartEnd
726
Signal Peptide
Cleavage Site
18
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_004_00487.1Aquca_005_00170.1Aquca_039_00098.1Aquca_002_00153.1Aquca_002_00152.1
Aquca_445_00001.1Aquca_002_00155.1Aquca_002_00172.1Aquca_002_00174.1Aquca_002_00176.1
Aquca_296_00002.1Aquca_003_00143.1Aquca_002_00175.1Aquca_296_00001.1Aquca_002_00173.1
Arabidopsis lyrata908444312453888837
Arabidopsis thalianaAT5G05340.1AT1G14550.1AT5G58400.1AT5G58390.1AT1G14540.1
Brachypodium distachyonBradi5g24200.1Bradi4g25660.1Bradi1g17860.1Bradi1g63060.1Bradi4g44530.1
Bradi3g09130.1Bradi1g38310.1Bradi1g38290.1Bradi3g09080.1Bradi1g38297.1
Bradi1g17870.1Bradi1g17877.1Bradi3g09100.1Bradi3g09140.1Bradi1g63067.1
Bradi3g09120.1Bradi1g17840.1Bradi5g19857.1Bradi1g41115.1Bradi1g38350.1
Bradi3g09087.1Bradi1g57247.1Bradi1g17790.1Bradi1g17850.1Bradi2g06497.1
Bradi1g39190.1
Brassica rapaBra028761Bra006769Bra005850Bra020370Bra026207
Carica papayaevm.model.supercontig_19.93evm.model.supercontig_19.109evm.model.supercontig_2.330evm.model.supercontig_173.15
Capsella rubellaCarubv10001455mCarubv10012474mCarubv10026803mCarubv10010887m
Citrus sinensisorange1.1g020615morange1.1g020951morange1.1g020966morange1.1g021171morange1.1g024722m
orange1.1g024025m
Cucumis sativusCucsa.326110.1Cucsa.229260.1Cucsa.229270.1Cucsa.000280.1Cucsa.151970.1
Cucsa.000260.1Cucsa.195750.1Cucsa.000240.1Cucsa.000290.1Cucsa.000230.1
Cucsa.397150.1
Eucalyptus grandisEucgr.A00682.1
Fragaria vescamrna13837.1-v1.0-hybridmrna21309.1-v1.0-hybridmrna28149.1-v1.0-hybridmrna28140.1-v1.0-hybridmrna15456.1-v1.0-hybrid
mrna06156.1-v1.0-hybridmrna15778.1-v1.0-hybridmrna00894.1-v1.0-hybridmrna28142.1-v1.0-hybridmrna21310.1-v1.0-hybrid
mrna28145.1-v1.0-hybrid
Glycine maxGlyma09g41450.1Glyma18g44310.1Glyma06g15030.1Glyma04g39860.1Glyma14g38150.1
Glyma02g40000.1Glyma14g05840.1Glyma02g42730.1Glyma18g06250.1Glyma11g29890.1
Glyma09g41440.1Glyma18g44320.2Glyma06g42850.1Glyma14g05850.1Glyma12g15460.1
Glyma02g40040.1Glyma14g38210.1Glyma01g32310.1Glyma20g31190.1Glyma01g32270.1
Glyma03g04710.1Glyma11g10750.2Glyma03g04720.1Glyma11g30010.1Glyma03g04740.1
Glyma03g04700.1Glyma03g04660.1Glyma10g36380.1Glyma12g33940.1Glyma03g04880.1
Glyma03g04750.1Glyma18g06210.1Glyma14g38170.1Glyma18g06230.1Glyma02g40020.1
Glyma20g38590.1Glyma18g06220.1Glyma11g29920.1Glyma02g40010.1Glyma03g04670.1
Glyma03g04760.1Glyma03g04870.2
Gossypium raimondiiGorai.011G129900.1Gorai.012G016200.2Gorai.012G016200.3Gorai.012G016200.1Gorai.009G361800.1
Gorai.003G151700.1Gorai.009G295200.1Gorai.013G005800.1Gorai.004G234900.1Gorai.011G211400.2
Gorai.011G211400.1Gorai.011G211300.1Gorai.003G151700.2Gorai.002G168400.1Gorai.006G233900.1
Gorai.006G233800.1Gorai.011G129900.2Gorai.N001400.1Gorai.011G129800.1Gorai.011G211100.1
Gorai.N001200.1Gorai.006G234100.1
Linum usitatissimumLus10034207Lus10003573Lus10032786Lus10006534Lus10030148
Lus10000346Lus10009898Lus10024209Lus10009900Lus10009902
Lus10025255Lus10024208Lus10009932Lus10009936Lus10009935
Lus10009933Lus10008581Lus10009899Lus10024207Lus10009937
Lus10025256
Malus domesticaMDP0000283650MDP0000306867MDP0000209189MDP0000207215MDP0000509183
MDP0000770103MDP0000264519MDP0000802295MDP0000481550MDP0000629636
MDP0000516992MDP0000319048MDP0000788664MDP0000280662MDP0000280527
MDP0000318348MDP0000672440MDP0000179781MDP0000525211
Manihot esculentacassava4.1_011779mcassava4.1_033971mcassava4.1_011653mcassava4.1_025314mcassava4.1_012124m
cassava4.1_021696mcassava4.1_011778mcassava4.1_011787mcassava4.1_029336mcassava4.1_028656m
cassava4.1_024245mcassava4.1_023529mcassava4.1_029862mcassava4.1_023324mcassava4.1_030936m
cassava4.1_033835mcassava4.1_025263mcassava4.1_022772mcassava4.1_025167mcassava4.1_028049m
cassava4.1_031287mcassava4.1_011804mcassava4.1_030211m
Medicago truncatulaMedtr3g094650.1Medtr7g072510.1Medtr3g094670.1Medtr3g072190.1Medtr2g084020.1
Medtr5g083860.1Medtr7g072480.1Medtr5g074970.1Medtr3g094630.1Medtr2g084010.1
Medtr2g084000.1Medtr2g084080.1Medtr4g083710.1Medtr2g084090.1Medtr5g074860.1
Medtr1g115900.1Medtr5g074760.1Medtr5g074740.1Medtr5g074710.1Medtr7g026990.1
Medtr4g074990.1Medtr4g074980.1Medtr5g074700.1
Mimulus guttatusmgv1a018175mmgv1a025851mmgv1a009759mmgv1a010078mmgv1a010234m
mgv1a010221mmgv1a010225mmgv1a009407mmgv1a021792mmgv1a010056m
Oryza sativaLOC_Os04g55740.1LOC_Os03g32050.1LOC_Os07g48030.1LOC_Os06g35520.1LOC_Os11g02130.1
LOC_Os12g02080.1LOC_Os07g48020.1LOC_Os06g35480.1LOC_Os06g35490.1LOC_Os07g47990.1
LOC_Os07g48050.1LOC_Os07g48010.1LOC_Os01g10850.1LOC_Os02g14460.1LOC_Os02g14440.1
LOC_Os02g14180.1LOC_Os03g22010.1LOC_Os03g22020.1LOC_Os12g02060.1LOC_Os11g02100.1
LOC_Os02g14430.1LOC_Os02g14160.1LOC_Os07g47990.2LOC_Os07g48040.1LOC_Os02g14170.1
LOC_Os07g48060.1LOC_Os03g22010.2LOC_Os06g33090.1LOC_Os07g48060.2LOC_Os06g32980.1
LOC_Os02g14170.2LOC_Os06g32960.1LOC_Os06g33100.1LOC_Os06g33080.1LOC_Os06g32990.1
Panicum virgatumPavirv00067485mPavirv00018711mPavirv00021622mPavirv00036086mPavirv00051399m
Pavirv00031908mPavirv00021061mPavirv00053626mPavirv00069991mPavirv00052674m
Pavirv00059991mPavirv00062304mPavirv00055741mPavirv00019867mPavirv00066040m
Pavirv00053035mPavirv00027382mPavirv00031572mPavirv00047081mPavirv00006281m
Pavirv00008801mPavirv00061978mPavirv00032127mPavirv00028214mPavirv00005761m
Pavirv00054303mPavirv00056186mPavirv00014663mPavirv00012121mPavirv00057516m
Pavirv00025324mPavirv00064764mPavirv00002919mPavirv00000566mPavirv00005406m
Pavirv00051390mPavirv00044144mPavirv00065002mPavirv00044944mPavirv00049496m
Pavirv00055773m
Phaseolus vulgarisPhvul.008G249900.1Phvul.009G140700.1Phvul.008G218500.1Phvul.006G075600.1Phvul.008G086800.1
Phvul.005G094200.1Phvul.011G128200.1Phvul.011G030100.1Phvul.010G066800.1Phvul.011G030200.1
Phvul.010G066900.1Phvul.008G249500.1Phvul.010G066700.1Phvul.006G075800.1Phvul.006G075700.1
Phvul.010G066600.1Phvul.007G008400.1Phvul.008G249700.1Phvul.006G075900.1Phvul.008G249800.1
Picea abiesMA_10432379g0020MA_10435976g0010MA_256822g0010MA_186345g0010MA_10070756g0010
MA_204088g0010MA_185360g0010MA_170257g0010MA_66808g0010MA_10430929g0010
MA_502530g0010MA_656798g0010MA_42401g0010MA_74620g0010MA_662921g0010
MA_124869g0010MA_25919g0010MA_31518g0010MA_10431506g0010MA_8643639g0010
MA_207021g0010
Populus trichocarpaPotri.013G083600.1Potri.013G154400.1Potri.013G156500.2Potri.014G143200.1Potri.T163200.1
Potri.010G236900.1Potri.014G143200.2Potri.T163100.1Potri.001G458900.1Potri.013G156400.1
Potri.T163000.1Potri.T160100.1Potri.001G458700.1Potri.008G022700.1Potri.008G022600.1
Potri.T160000.1Potri.006G107000.1Potri.016G132900.1Potri.016G132700.1Potri.016G132800.1
Potri.013G156800.1Potri.T160000.2
Prunus persicappa008820mppa008607mppa008642mppa008590mppa018664m
ppa023604mppa008808mppa020902mppa018900mppa020254m
ppa019253mppa018701mppa018750mppa015551m
Ricinus communis29729.m00233329780.m00134929780.m00133429780.m00135029780.m001335
29957.m00141830190.m01115130190.m01114329780.m00135130015.m000223
30190.m01114630190.m01115030015.m00022230190.m01114830190.m011144
30190.m011145
Setaria italicaSi012779mSi026617mSi006893mSi006946mSi030339m
Si030597mSi010606mSi010609mSi030426mSi026644m
Si030595mSi030601mSi036577mSi030593mSi019982m
Si030562mSi017811mSi006919mSi036729mSi019256m
Si011925mSi030527mSi017780mSi017813mSi002252m
Si017097mSi030541mSi008174mSi006869mSi008158m
Si030658mSi008422m
Selaginella moellendorffii101253106421232269114366101258
228326232270414521421525418626
81737
Sorghum bicolorSb05g001000.1Sb05g001030.1Sb10g021650.1Sb08g000990.1Sb05g001010.1
Sb06g030940.1Sb10g021630.1Sb10g021610.1Sb0246s002010.1Sb10g021620.1
Sb04g008620.1Sb01g031740.1Sb04g008650.1Sb02g042850.1Sb02g042870.1
Sb02g042840.1Sb01g035990.1Sb10g021640.1Sb02g037840.1Sb02g042860.1
Sb04g008630.1Sb04g008590.1Sb02g042880.1Sb03g002370.1Sb10g020100.1
Thellungiella halophilaThhalv10014105mThhalv10014097mThhalv10023814mThhalv10008244m
Vitis viniferaGSVIVT01030221001GSVIVT01024596001GSVIVT01009107001GSVIVT01020737001GSVIVT01010271001
GSVIVT01024600001GSVIVT01009106001GSVIVT01009109001GSVIVT01010269001GSVIVT01010267001
GSVIVT01010270001GSVIVT01010268001GSVIVT01010272001
Zea maysAC197758.3_FGT004
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)