y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna28146.1-v1.0-hybrid
FamilyAA2
Protein PropertiesLength: 239 Molecular Weight: 25766.8 Isoelectric Point: 5.6487
ChromosomeChromosome/Scaffold: 3 Start: 20368930 End: 20372947
DescriptionPeroxidase superfamily protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2722049.6e-23
  LGGPSYSYEVLLGRRDATTTSINDANRNLPPPFFNFPQLLSNFQSHGLDLQDLVLLSAGHTIGLARSSLKQGCPSNGGDDNTAPLDSTTASFDTDHFKAL
  LEKKGLLHSDQELFKGDGSDSDNLVQHYANNPK
Full Sequence
Protein Sequence     Length: 239     Download
MATSGVYPRV CLLERFVDRC QRMVVTRVDS EGKTSNTISG LPELAASDST FDVVAGGRAT    60
VPTRRRLDED ELGGPSYSYE VLLGRRDATT TSINDANRNL PPPFFNFPQL LSNFQSHGLD    120
LQDLVLLSAG HTIGLARSSL KQGCPSNGGD DNTAPLDSTT ASFDTDHFKA LLEKKGLLHS    180
DQELFKGDGS DSDNLVQHYA NNPKDFAVDF GASLIKMGNM KPLTGSGGEI RLNCRKIN*     240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00691ascorbate_peroxidase0.001118217113+
cd00314plant_peroxidase_like4.0e-647219193+
pfam00141peroxidase7.0e-971202132+
PLN03030PLN030304.0e-1278238193+
cd00693secretory_peroxidase3.0e-5072237193+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1sch_B072238112294A Chain A, Peanut Peroxidase
PDB1sch_A072238112294A Chain A, Peanut Peroxidase
PDB1qo4_A4e-3573238114304A Chain A, Peanut Peroxidase
PDB1pa2_A4e-3573238114304A Chain A, Arabidopsis Thaliana Peroxidase A2
PDB1fhf_C4e-3073238113303A Chain A, The Structure Of Soybean Peroxidase
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_003_00142.1Aquca_029_00102.1
Brachypodium distachyonBradi4g44510.1Bradi5g00690.1
Citrus sinensisorange1.1g022375morange1.1g025013m
Fragaria vescamrna21306.1-v1.0-hybrid
Linum usitatissimumLus10030145.156.325Lus10030145.156.325
Medicago truncatulaMedtr3g072210.1
Oryza sativaLOC_Os03g22010.3LOC_Os12g02080.2
Panicum virgatumPavirv00064327mPavirv00026915mPavirv00051402mPavirv00019628m
Picea abiesMA_414832g0010MA_10433993g0010MA_19749g0010MA_10430578g0010MA_91956g0010
MA_746078g0010MA_74610g0010
Populus trichocarpaPotri.013G156500.1.166.334Potri.013G156500.1.166.334
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny