y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna28152.1-v1.0-hybrid
FamilyCBM22
Protein PropertiesLength: 586 Molecular Weight: 65248.4 Isoelectric Point: 6.6285
ChromosomeChromosome/Scaffold: 3 Start: 20403697 End: 20405454
DescriptionGlycosyl hydrolase family 10 protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM22501686.7e-21
  IIVNPELNHGLRGWSTFGNAKLQHRESQAGNKFAVACNRNQPHAGISQKTYLQGNKLYTFSAWIQVSGGRGVPVTAIFKTSSGSFIHAGAIVAESNCWSM
  MKGGLTVNASGPAELYFES
GH102284910
  KAPSFPFGCAMNKNILANTAYQNWFTSRFGVTTFENEMKWYSTENSQGKEDYSVADAMLQFAKQHNIAVRGHNVFWDDPQYQLGWVTSLDKHQLALAAFK
  RLYSVMNRYKGQVIAWDVVNENLHFDFFESKWGKNSSAILYNWATKADGETTLFMNEFNTIEESEDGDSTPAKYLQKLRDIQAFPGNNNLKMAIGLESHF
  RSPNIPYIRSSIDTLAAANLPIWITELDVQSGPNQAWYLEQIMREVYTHPKIQGIIIWAAWRPE
Full Sequence
Protein Sequence     Length: 586     Download
MTTGGKSNLL LLLLCTFLFP RFEVNALSYD YSASIECLEN PHKPQYGGGI IVNPELNHGL    60
RGWSTFGNAK LQHRESQAGN KFAVACNRNQ PHAGISQKTY LQGNKLYTFS AWIQVSGGRG    120
VPVTAIFKTS SGSFIHAGAI VAESNCWSMM KGGLTVNASG PAELYFESKN TSVDIWVDSV    180
SLQPFTEKEW KSHHDQSIEK NRKSNVRIQA VDAEGNPLRN ATISIQQKAP SFPFGCAMNK    240
NILANTAYQN WFTSRFGVTT FENEMKWYST ENSQGKEDYS VADAMLQFAK QHNIAVRGHN    300
VFWDDPQYQL GWVTSLDKHQ LALAAFKRLY SVMNRYKGQV IAWDVVNENL HFDFFESKWG    360
KNSSAILYNW ATKADGETTL FMNEFNTIEE SEDGDSTPAK YLQKLRDIQA FPGNNNLKMA    420
IGLESHFRSP NIPYIRSSID TLAAANLPIW ITELDVQSGP NQAWYLEQIM REVYTHPKIQ    480
GIIIWAAWRP EGCYRMCLTD NNFKNLPTGD VVDKLLSEWG LKAGFASSAT TDTNGVFEAS    540
LPHGDYEVQI TDLESVKVSN AMVQGLNVAA SSSASQQPLL VQLAA*                   600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02018CBM_4_90.00457172123+
COG3693XynA2.0e-30256456213+
pfam00331Glyco_hydro_102.0e-50229504302+
smart00633Glyco_101.0e-69265512273+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0016798hydrolase activity, acting on glycosyl bonds
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1nq6_A5e-2623451215298A Chain A, Crystal Structure Of The Catalytic Domain Of Xylanase A From Streptomyces Halstedii Jm8
PDB1tux_A3e-2523451618301A Chain A, High Resolution Crystal Structure Of A Thermostable Xylanase From Thermoascus Aurantiacus
PDB1ta3_B3e-2323448917277B Chain B, Crystal Structure Of Xylanase (Gh10) In Complex With Inhibitor (Xip)
PDB1i1x_A7e-2323451818303B Chain B, Crystal Structure Of Xylanase (Gh10) In Complex With Inhibitor (Xip)
PDB1i1w_A7e-2323451818303A Chain A, 0.89a Ultra High Resolution Structure Of A Thermostable Xylanase From Thermoascus Aurantiacus
Signal Peptide
Cleavage Site
26
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_011_00218.1.27.143Aquca_011_00219.1.49.165
Arabidopsis lyrata913024.46.162491295.46.161
Arabidopsis thalianaAT4G33840.1.46.161AT4G33830.1.47.162AT4G33860.1.46.161
Brachypodium distachyonBradi1g71040.1.54.172
Brassica rapaBra034585.47.155Bra034584.46.161Bra017609.141.256
Carica papayaevm.model.supercontig_106.45.53.168
Capsella rubellaCarubv10006586m.46.161
Citrus clementinaCiclev10030382m.52.167
Fragaria vescamrna28152.1-v1.0-hybrid.50.168
Glycine maxGlyma11g11200.1.73.188Glyma11g11220.1.35.152
Linum usitatissimumLus10020985.24.142Lus10033786.35.153Lus10014642.40.158
Malus domesticaMDP0000245498.55.170
Manihot esculentacassava4.1_021918m.41.156
Mimulus guttatusmgv1a003597m.49.165
Oryza sativaLOC_Os03g10478.1.55.172LOC_Os03g10440.1.51.167
Panicum virgatumPavirv00027101m.14.130Pavirv00026745m.37.153
Phaseolus vulgarisPhvul.011G033100.1.41.156
Picea abiesMA_429144g0010.58.183MA_10434167g0010MA_7941351g0010
Populus trichocarpaPotri.009G087900.1.27.142
Prunus persicappa021363m.43.158
Ricinus communis29812.m000195.44.159
Setaria italicaSi034867m.54.170Si034912m.47.163
Selaginella moellendorffii420481.76.197
Thellungiella halophilaThhalv10024995m.45.160Thhalv10027468m.47.162
Vitis viniferaGSVIVT01037833001.70.185GSVIVT01037825001.23.138
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny