y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna28201.1-v1.0-hybrid
FamilyGT1
Protein PropertiesLength: 717 Molecular Weight: 81157.4 Isoelectric Point: 4.8117
ChromosomeChromosome/Scaffold: 3 Start: 20669964 End: 20676224
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT14816932.1e-35
  ELEPEVIDALRQTIPIPVYHIGPTIPYFKVETHSRPNGDYYFDWLDKQPRGSVLYVSQGSLHSAPQAQMDEIAAGLKASGARFFWVAREEVSELKEKCGD
  MGIVVPWCDQLTVLCHPSLGGFWSHCGWNSTSEAVYAGLPMLTFPIYWDQVPNSKMIVEDWKIGWRVKKGSGEEGLVSREEIAGLVRKFLDLENEEAKET
  RKRARKLSEIYRQ
Full Sequence
Protein Sequence     Length: 717     Download
MRYHSFLRSP KKEEQQVPDS ANSSEEFSDT TKDGYVNGKV DIMDDLERIW GIDEDGDEED    60
DEKPQKNHNM FAGQELNWDF MDWDEFPNGE EGDGEVENEV FGDSERCFFE EESYCKKVVK    120
KESSTVGFWN DDEDMKKVQL NLNLNYQEVL DAWSDRGSLW AEDCSSHSSM AASNGNYMGE    180
VPVMEEEKSI RREASVLRYR EKRQSRLFSK KIRYQVRKLN ADKRPRLKSL SSSSSSSAHS    240
SLSSFSLSPS DYQPIPNNPE MDHLHTPQPT TPCHVVALPF PGRGHINPMM CLCHSIAAIS    300
PDMTVSFIVT QEWLGFIGSD PKPDNVRFVT IPQVIPSEIG RGKDSPAFYE TVLRKIKAPV    360
EELLDRLEPP VTALIADTYL VWSVEIGNVR NIPVASLWTM SASVYSVFQY FDLLVQNHHF    420
PVKLAETGEE RVDYIPGLPS TRVADLPTCF YGKGLNILDT ALESVSCLTK AQYLLLPSVY    480
ELEPEVIDAL RQTIPIPVYH IGPTIPYFKV ETHSRPNGDY YFDWLDKQPR GSVLYVSQGS    540
LHSAPQAQMD EIAAGLKASG ARFFWVAREE VSELKEKCGD MGIVVPWCDQ LTVLCHPSLG    600
GFWSHCGWNS TSEAVYAGLP MLTFPIYWDQ VPNSKMIVED WKIGWRVKKG SGEEGLVSRE    660
EIAGLVRKFL DLENEEAKET RKRARKLSEI YRQAVRKGGS SYNNVEAFIS DISKMK*       720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN03007PLN030073.0e-51354716389+
PLN02410PLN024102.0e-52275709450+
PLN02210PLN022104.0e-56274713463+
PLN02555PLN025558.0e-66269716489+
PLN02448PLN024480269716453+
Gene Ontology
GO TermDescription
GO:0005515protein binding
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2pq6_A027471210477A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vg8_A2.00386e-432747018456A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vch_A2.00386e-432747018456A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vce_A2.00386e-432747018456A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2acv_B2e-3827571312462A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_030_00224.2Aquca_030_00224.1Aquca_030_00223.1Aquca_030_00247.1
Arabidopsis lyrata481926481925
Arabidopsis thalianaAT2G30150.1AT2G30140.1AT2G30140.2
Brachypodium distachyonBradi2g21317.1Bradi2g52740.1Bradi2g52750.1
Brassica rapaBra018333Bra022781Bra018334
Carica papayaevm.model.supercontig_46.189evm.model.supercontig_2.368
Capsella rubellaCarubv10023179mCarubv10023176m
Citrus clementinaCiclev10028376mCiclev10028375mCiclev10028356mCiclev10029825m
Citrus sinensisorange1.1g012096morange1.1g044218m
Cucumis sativusCucsa.139460.1Cucsa.139470.1
Eucalyptus grandisEucgr.B00404.1Eucgr.B00406.1Eucgr.J01864.1Eucgr.J01863.1Eucgr.J01875.1
Eucgr.B03993.1Eucgr.B03996.1Eucgr.J01877.1Eucgr.J01867.1Eucgr.B03994.1
Eucgr.B03997.2Eucgr.B03997.1Eucgr.J01880.1Eucgr.J01869.1Eucgr.B00411.1
Eucgr.J01874.1Eucgr.J01870.1Eucgr.B00409.1Eucgr.J01868.1Eucgr.J01873.1
Fragaria vescamrna28195.1-v1.0-hybridmrna28196.1-v1.0-hybridmrna28194.1-v1.0-hybridmrna28199.1-v1.0-hybridmrna28200.1-v1.0-hybrid
mrna28193.1-v1.0-hybrid
Glycine maxGlyma02g39680.1Glyma02g39700.2Glyma14g37770.1Glyma14g37730.1Glyma04g36200.1
Glyma04g36200.2Glyma02g39700.1Glyma11g29480.2
Gossypium raimondiiGorai.013G271000.1Gorai.009G113100.1Gorai.009G113100.2Gorai.013G270900.1Gorai.013G271100.1
Linum usitatissimumLus10042260Lus10026394Lus10026393Lus10042261Lus10042262
Lus10042264
Malus domesticaMDP0000593031MDP0000376869MDP0000173539MDP0000222559MDP0000686301
MDP0000396630MDP0000396403MDP0000739392.384.594MDP0000739392.384.594MDP0000263453
MDP0000317841MDP0000276057MDP0000379060MDP0000902216MDP0000156246
MDP0000313145MDP0000166802MDP0000229763MDP0000811246
Manihot esculentacassava4.1_007402mcassava4.1_007201m
Medicago truncatulaMedtr5g072810.1Medtr5g072830.1Medtr5g072820.1Medtr5g072840.1Medtr5g072860.1
Medtr3g031400.1Medtr3g031450.1Medtr5g075440.1Medtr5g072850.1
Mimulus guttatusmgv1a005987mmgv1a021616m
Oryza sativaLOC_Os01g59110.1LOC_Os01g59100.1LOC_Os05g41400.1
Panicum virgatumPavirv00005550mPavirv00033216mPavirv00018377mPavirv00053061m
Phaseolus vulgarisPhvul.008G256800.2Phvul.008G256800.1Phvul.008G256600.1Phvul.008G256600.2Phvul.008G257200.1
Picea abiesMA_10434904g0010
Populus trichocarpaPotri.001G281900.1Potri.001G282100.1Potri.009G077400.1Potri.009G077200.1Potri.009G077500.1
Potri.001G281800.1
Prunus persicappa015751mppa022795mppa024989mppa006015mppa019639m
ppa026425mppa005406m
Ricinus communis27561.m00029029628.m000755
Setaria italicaSi004951mSi024733mSi024959mSi001326m
Selaginella moellendorffii439509
Sorghum bicolorSb03g037450.1Sb03g037440.1Sb09g024190.1
Thellungiella halophilaThhalv10025222mThhalv10016641m
Vitis viniferaGSVIVT01024653001GSVIVT01024655001GSVIVT01024656001GSVIVT01024649001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)