y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna28254.1-v1.0-hybrid
FamilyGT10
Protein PropertiesLength: 550 Molecular Weight: 61906.4 Isoelectric Point: 7.1986
ChromosomeChromosome/Scaffold: 3 Start: 20985658 End: 20990028
Descriptionfucosyltransferase 12
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT101854260
  FHRKSSSTSFKIVYGLVSRKMKGYNIVMTTSLSSDVPVGYFSWAEYDIMAPILPKTEKALAAAFISNCGARNFRLQALEALEKTNITIDSYGGCHRNRDG
  KVDKVQTLKRYKFSLAFENSNEEDYVTEKYFQSLVAGTIPVVVGPPNIEEFSPGPGSILFIKELSDVESVAKTMKKLADNPEAYNQSLSLFLYEDANMLR
  YLITRWKYEGPSDSFKALVDMAAVHSSCRLCIHLATMIREKE
Full Sequence
Protein Sequence     Length: 550     Download
MGVFSFQRGS RTATTHEALP VSGAGASSPA TNKRRWSNLM PFVVAFVVIA EISFLGKLDL    60
ANKAALVDSW TELFSPIPMV SGREDLGLAG DDLGLLTCEE WLEREDAVEY SRDFAKEPVL    120
VSGDEKDWKS CSVGCQFGDN SGRKPDAAFG FGHQDGTSSV LRSMESAQYY AENNIDNARR    180
WELQFHRKSS STSFKIVYGL VSRKMKGYNI VMTTSLSSDV PVGYFSWAEY DIMAPILPKT    240
EKALAAAFIS NCGARNFRLQ ALEALEKTNI TIDSYGGCHR NRDGKVDKVQ TLKRYKFSLA    300
FENSNEEDYV TEKYFQSLVA GTIPVVVGPP NIEEFSPGPG SILFIKELSD VESVAKTMKK    360
LADNPEAYNQ SLSLFLYEDA NMLRYLITRW KYEGPSDSFK ALVDMAAVHS SCRLCIHLAT    420
MIREKEESSL EFKRRPCKCT RGSGVVYHLY LRERGRFEME SIYIRSSNLT LEAFESLVLT    480
KFQSQKHVPI WKEERPEVLR GGDNFKVYRI YPVGLTQRQA LYTFRFKGDA DFRSHVESNP    540
CAKFEVIFV*                                                           600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00852Glyco_transf_102.0e-31209424225+
Gene Ontology
GO TermDescription
GO:0006486protein glycosylation
GO:0008417fucosyltransferase activity
GO:0016020membrane
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2nzy_C0.00001246368183304A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct
PDB2nzy_B0.00001246368183304A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct
PDB2nzy_A0.00001246368183304A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct
PDB2nzx_C0.00001246368183304A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct
PDB2nzx_B0.00001246368183304A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_015_00060.3Aquca_015_00060.1Aquca_015_00060.2
Arabidopsis lyrata891881891885479443
Arabidopsis thalianaAT3G19280.1AT1G49710.1
Brachypodium distachyonBradi3g38160.2Bradi3g38160.1
Brassica rapaBra014210Bra018801Bra022408
Carica papayaevm.model.supercontig_62.7
Capsella rubellaCarubv10015682mCarubv10008875m
Chlamydomonas reinhardtiig18110.t1
Citrus clementinaCiclev10028212m
Citrus sinensisorange1.1g038682m
Cucumis sativusCucsa.219830.2Cucsa.219830.1Cucsa.219830.4Cucsa.244420.1Cucsa.219830.5
Cucsa.219830.3
Eucalyptus grandisEucgr.I01147.2Eucgr.I01147.1Eucgr.I01147.3
Glycine maxGlyma07g33580.1Glyma02g14890.1Glyma07g33580.2
Gossypium raimondiiGorai.013G044300.2Gorai.002G008200.2Gorai.008G024900.1Gorai.013G044300.1Gorai.002G008200.1
Linum usitatissimumLus10027899Lus10014060Lus10002401Lus10019855
Malus domesticaMDP0000275804MDP0000322244
Manihot esculentacassava4.1_005385mcassava4.1_009428m
Medicago truncatulaMedtr4g086010.1
Mimulus guttatusmgv1a005269m
Oryza sativaLOC_Os08g36840.1
Panicum virgatumPavirv00032486m
Physcomitrella patensPp1s31_233V6.3Pp1s31_233V6.1
Phaseolus vulgarisPhvul.003G292000.1
Picea abiesMA_100562g0010
Populus trichocarpaPotri.009G101500.3Potri.009G101500.4Potri.009G101500.1Potri.009G101500.2
Prunus persicappa004581m
Ricinus communis29801.m003181
Setaria italicaSi013627m
Selaginella moellendorffii164166
Sorghum bicolorSb07g022980.1
Thellungiella halophilaThhalv10011402m
Vitis viniferaGSVIVT01031736001
Volvox carteriVocar20004454m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny