y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna28256.1-v1.0-hybrid
FamilyCBM43
Protein PropertiesLength: 164 Molecular Weight: 16916.3 Isoelectric Point: 7.7468
ChromosomeChromosome/Scaffold: 3 Start: 20999260 End: 21000025
DescriptionO-Glycosyl hydrolases family 17 protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM43791581.6e-21
  WCIGKKDILTSLLKTAFDEICKEVDCSPTGPTGICYDESIWSKASYAMNLKYQKNGQKDSDCDNQGTSHIVTIDPSWGKC
Full Sequence
Protein Sequence     Length: 164     Download
MAPNFFVASV LLLQLAAIAF SIRLPYYPPR PDKGIPGGPA LGLPGGPAAG IPTQQEGPAG    60
GSTTAPGAAV GGANSGKKWC IGKKDILTSL LKTAFDEICK EVDCSPTGPT GICYDESIWS    120
KASYAMNLKY QKNGQKDSDC DNQGTSHIVT IDPSWGKCVL ISS*                     180
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam07983X86.0e-117814578+
smart00768X84.0e-227815984+
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2jon_A0.0000000005781621298A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9
Transmembrane Domains
StartEnd
527
Signal Peptide
Cleavage Site
21
Hydropathy
Orthologous Group
SpeciesID
Fragaria vescamrna26604.1-v1.0-hybrid.222.303mrna26604.1-v1.0-hybrid.222.303mrna26604.1-v1.0-hybrid.222.303mrna26604.1-v1.0-hybrid.128.194mrna26604.1-v1.0-hybrid.128.194
mrna26604.1-v1.0-hybrid.128.194mrna10336.1-v1.0-hybrid
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny