y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna28330.1-v1.0-hybrid
FamilyGH38
Protein PropertiesLength: 1161 Molecular Weight: 133010 Isoelectric Point: 7.1872
ChromosomeChromosome/Scaffold: 4 Start: 10081785 End: 10085883
Descriptiongolgi alpha-mannosidase II
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH381494880
  KVVVVPHSHNDPGWKLTVAEYYERQSRHILDTIVATLSKDTRRKFIWEEMSYLERWWKDSADDKRELFTNLVKNGQLEIVGGGWVMNDEANSHYYAIIEQ
  ITEGNLWLNETVGVIPKNSWAIDPFGYSSTMAYLLRRMGFENMLIQRTHYELKKELALHKNLEYIWRQSWDVDESTDIFVHMMPFYSYDVPHTCGPEPAI
  CCQFDFARMRGFMYEFCPWGDNPVETNQENVQERALLLLDQYKKKSTLYRTNTLLIPLGDDFRYVSIEEAEAQFRNYQMLFDYINSNPSLNAEAHFGTLE
  DYFRTLREEAERINHTRPGEIGSGQVGGFPSLSGDFFTYA
Full Sequence
Protein Sequence     Length: 1161     Download
MAFSSFSARR GGAWPHSLLP STTASSKSKH TRKPRRRLLL RDFLFANFFT IGLSVSLFFF    60
FLLLLRYGVP HPITAGFKYS RSPIRFSKPP RKPVARKPGQ NDDVSGAAVD ITTKELYDKI    120
EFSDVDGGPW KQGWRVGYRG DEWDSEKLKV VVVPHSHNDP GWKLTVAEYY ERQSRHILDT    180
IVATLSKDTR RKFIWEEMSY LERWWKDSAD DKRELFTNLV KNGQLEIVGG GWVMNDEANS    240
HYYAIIEQIT EGNLWLNETV GVIPKNSWAI DPFGYSSTMA YLLRRMGFEN MLIQRTHYEL    300
KKELALHKNL EYIWRQSWDV DESTDIFVHM MPFYSYDVPH TCGPEPAICC QFDFARMRGF    360
MYEFCPWGDN PVETNQENVQ ERALLLLDQY KKKSTLYRTN TLLIPLGDDF RYVSIEEAEA    420
QFRNYQMLFD YINSNPSLNA EAHFGTLEDY FRTLREEAER INHTRPGEIG SGQVGGFPSL    480
SGDFFTYADR QQDYWSGYYV SRPFFKAVDR VLEHTLRATD MMMAFLLGYC GRAQCEKLPI    540
GFSYKLAAAR RNLALFQHHD GVTGTAKDHV VLDYGMRMHT SLQDLQIFMS KAIEVLLGIR    600
HDKYDINPSQ FEPEQVRSKY DVQPVHRAIM AREGTRQTVV LFNPSEQIRE EVVMVIVNRP    660
DVTVLDLNWT CVPSQISPEL QHDKSKIFTG RHRVYWQASV PALGLQTYYI TNGFAGCEKA    720
KPAKIRYFSK SGSFSCPTPY PCSKVEADVA EIQNRHQTLT FDVNHGLLQK ISYKTGTQNV    780
VGEEIAMYSS WGSGAYLFKP DGDAQPIIAA GGQMVISEGP LVQEVYSYPS TQWEKSPISH    840
STRLYNGENT VQEFLIEKEY HVELLDQQFN DRELIVRYKT DIDNKRVFFS DLNGFQMSRR    900
ETYNKIPLQG NYYPMPSLAF MQGSNGQRFS VHSRQSLGVA SLKNGWLEIM LDRRLVRDDG    960
RGLGQGVMDN RAMNVVFHIL VEANISSASN PVSNPLPLNP SLLSHRVGAD LNYPLHAFVS    1020
KKPEDLSVQP PLRSFSPLAA PLPCDLHIVS LKVPQPLKFS QPPLEDSRFV LTLQRRSWDS    1080
SYCRKGRSNC TRFADETVNL LNMFRELTVS NGRPTSLNLL HEDTDMLGYP EQFGDVAAEG    1140
QVLISPMEIQ AYKMELQPHQ *                                              1200
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00451GH38N_AMII_euk3.0e-106148434288+
cd11667GH38N_Man2A25.0e-150148499352+
cd11666GH38N_Man2A18.0e-155148499355+
PLN02701PLN02701010911571051+
cd10809GH38N_AMII_GMII_SfManIII_like0147499353+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004559alpha-mannosidase activity
GO:0005975carbohydrate metabolic process
GO:0006013mannose metabolic process
GO:0008270zinc ion binding
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3eju_A081102917943A Chain A, Arabidopsis Thaliana Peroxidase N
PDB3ejt_A081102917943A Chain A, Arabidopsis Thaliana Peroxidase N
PDB3ejs_A081102917943A Chain A, Arabidopsis Thaliana Peroxidase N
PDB3ejr_A081102917943A Chain A, Arabidopsis Thaliana Peroxidase N
PDB3ejq_A081102917943A Chain A, Arabidopsis Thaliana Peroxidase N
Transmembrane Domains
StartEnd
4365
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_00345.1.265.483Aquca_002_00345.1.265.483Aquca_006_00230.1Aquca_006_00257.5Aquca_006_00257.9
Aquca_006_00257.8Aquca_006_00257.7Aquca_006_00257.6Aquca_006_00257.4Aquca_006_00257.3
Aquca_006_00257.2Aquca_006_00257.1Aquca_043_00016.7Aquca_043_00016.8Aquca_043_00016.6
Aquca_043_00016.5Aquca_043_00016.4Aquca_043_00016.3Aquca_043_00016.2Aquca_043_00016.1
Aquca_043_00019.2Aquca_043_00019.1Aquca_043_00018.1Aquca_056_00071.1Aquca_002_00345.1.162.261
Aquca_002_00345.1.162.261
Arabidopsis lyrata488339488225497001484445
Arabidopsis thalianaAT5G14950.1AT5G66150.1AT5G13980.3AT5G13980.2AT5G13980.1
AT3G26720.2AT3G26720.1
Brachypodium distachyonBradi1g44550.1Bradi3g21117.1Bradi4g17327.1Bradi4g17317.1
Brassica rapaBra023496Bra006275Bra037183Bra006227Bra025225
Carica papayaevm.model.supercontig_6.275evm.model.supercontig_70.70evm.model.supercontig_2646.1evm.TU.contig_36966.1evm.model.supercontig_70.69
Capsella rubellaCarubv10000075mCarubv10002909mCarubv10027738mCarubv10016625m
Citrus clementinaCiclev10014083mCiclev10017635mCiclev10024829mCiclev10024800mCiclev10030627m
Ciclev10014156mCiclev10014160mCiclev10014123m
Citrus sinensisorange1.1g002547morange1.1g002518morange1.1g002134morange1.1g001061morange1.1g015028m
orange1.1g002366morange1.1g004057morange1.1g001910morange1.1g001850morange1.1g002764m
orange1.1g002170morange1.1g002162morange1.1g002383morange1.1g001963morange1.1g001813m
orange1.1g002938morange1.1g002542morange1.1g002064morange1.1g002056morange1.1g002046m
orange1.1g002036m
Cucumis sativusCucsa.339310.1Cucsa.043720.1Cucsa.188400.2Cucsa.188400.1
Eucalyptus grandisEucgr.J02166.1Eucgr.L01536.1Eucgr.J02456.1Eucgr.K02195.1Eucgr.J02455.3
Eucgr.J02455.2Eucgr.J02455.1Eucgr.I01600.1Eucgr.G01931.1Eucgr.J02460.1
Eucgr.J02454.1Eucgr.L01537.1Eucgr.J02457.1Eucgr.J02459.2Eucgr.J02459.1
Fragaria vescamrna14585.1-v1.0-hybridmrna01394.1-v1.0-hybrid.37.348mrna01394.1-v1.0-hybrid.37.348mrna06416.1-v1.0-hybrid.39.351mrna06416.1-v1.0-hybrid.39.351
mrna14589.1-v1.0-hybrid.71.344
Glycine maxGlyma13g04761.3Glyma13g04761.2Glyma19g01890.1Glyma13g04761.1Glyma02g05240.2
Glyma02g05240.1Glyma16g23600.1Glyma01g36980.1Glyma06g17270.1Glyma04g37790.1
Glyma19g27660.2Glyma19g27660.1Glyma16g05240.2Glyma16g05240.1
Gossypium raimondiiGorai.001G258600.2Gorai.001G258600.1Gorai.006G027500.1Gorai.003G008600.2Gorai.003G008600.1
Gorai.006G000300.3Gorai.006G000300.2Gorai.006G000300.1Gorai.012G082700.6Gorai.012G082700.9
Gorai.012G082700.8Gorai.012G082700.7Gorai.012G082700.5Gorai.012G082700.4Gorai.012G082700.3
Gorai.012G082700.2Gorai.012G082700.10Gorai.012G082700.1Gorai.003G116600.2Gorai.003G116600.1
Linum usitatissimumLus10014507Lus10015337.248.571Lus10015337.248.571Lus10032179Lus10039457
Lus10012578Lus10035111Lus10012577Lus10036074Lus10025960
Lus10014259Lus10041516Lus10015337.158.248Lus10015337.158.248
Malus domesticaMDP0000888429MDP0000267909MDP0000250936MDP0000139458MDP0000274501
MDP0000274500MDP0000409920MDP0000163211MDP0000657082MDP0000211018
Manihot esculentacassava4.1_000571mcassava4.1_001602mcassava4.1_000993mcassava4.1_000971mcassava4.1_000869m
cassava4.1_001123mcassava4.1_001106m
Medicago truncatulaMedtr4g071680.1Medtr6g008850.1Medtr8g075330.1Medtr7g084040.1Medtr3g098650.2
Medtr3g098650.1Medtr7g084030.1
Mimulus guttatusmgv1a000435mmgv1a000658mmgv1a000852mmgv1a000690m
Oryza sativaLOC_Os06g13650.2LOC_Os06g13650.1LOC_Os06g13650.3LOC_Os11g32260.2LOC_Os11g32260.1
LOC_Os10g05069.2LOC_Os10g05069.1LOC_Os10g05069.3
Panicum virgatumPavirv00027286mPavirv00014532mPavirv00024149mPavirv00025946mPavirv00065120m
Physcomitrella patensPp1s10_34V6.1Pp1s77_136V6.1Pp1s129_147V6.1
Phaseolus vulgarisPhvul.004G022500.1Phvul.003G264400.1Phvul.001G084400.1Phvul.002G107300.1Phvul.001G084700.1
Phvul.009G161600.1
Picea abiesMA_10434251g0010MA_879613g0010MA_4107059g0010
Populus trichocarpaPotri.017G073900.2Potri.017G073900.1Potri.001G350400.2Potri.001G350400.1Potri.014G143600.1
Potri.014G143600.2Potri.007G056300.1Potri.002G238200.2Potri.002G238200.1Potri.012G106500.2
Potri.012G106500.1
Prunus persicappa000458mppa021513mppa000707mppa000755mppa000717m
Ricinus communis29822.m00342029868.m00034130131.m00698230131.m00698130147.m014412
Setaria italicaSi005719mSi038673mSi025964mSi034056mSi025881m
Selaginella moellendorffii104910154366266756410022178241
Sorghum bicolorSb10g008770.1Sb01g026405.1Sb05g019600.1Sb01g026390.1
Thellungiella halophilaThhalv10012487mThhalv10012612mThhalv10012546mThhalv10003575mThhalv10003577m
Vitis viniferaGSVIVT01032586001GSVIVT01018752001GSVIVT01032988001GSVIVT01008340001GSVIVT01008642001
GSVIVT01032989001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)