y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna28731.1-v1.0-hybrid
FamilyGT48
Protein PropertiesLength: 2500 Molecular Weight: 305069 Isoelectric Point: 7.7382
ChromosomeChromosome/Scaffold: 6 Start: 29954500 End: 29987981
Descriptionglucan synthase-like 7
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT48175525140
  VPQNLDARRRITFFANSLFMNMPNAPKVRDMLSFSVLTPYYKEDVLYSDDELNKENEDGISILFYLQKIYPDEWTNFQDRINEHKNEYSDKDKSELIRQW
  VSYRGQTLSRTVRGMMYYRKALDLQCILETAGDGGVYGGYPAQILSEIDEKDILDRAQALADLKFTYVVSCQIYGEQKKSSESRDKSCYTNILKLMLTYP
  SLRVAYIDTREETVNGKSQKIYFSVLVKGGDKWDEEIYRIKLPGPPTVIGEGKPENQNHAIVFTRGEALQTIDMNQDNYFEEAFKMRNVLEEFRKPRRGQ
  RKPTILGLREHIFTGSVSSLAWFMSNQETSFVTIGQRILANPLRVRFHYGHPDIFDRLFHITRGGISKASKVINLSEDIFSGYNSVLRGGFITHHEYIQV
  GKGRDVGMNQISLFEAKVANGNGEQTLSRDVYRLGRRFDFYRMLSFYFTTVGFYFSSMADILGVQYFGNVFLFDTDTILFQVTVLTVYVFLYGRLYMVMS
  GLESEILDSPAIHQTKAFEEALATQSVFQLGLLLVLPMVMEIGLEKGFRTALGDFIIMQLQLASVFFTFQLGTKAHYYGRTILHGGSKYRATGRGFVVFH
  AKFADNYRLYSRSHFVKGLELLILLIVYGVYGNAYRSSNLYFFITFSMWFLVASWLFAPFIFNPSSFDWQKTVDDWTDWKRWMGNRGGIGISPDKSWESW
  WDEEQEHLKHTIIRGRILEIMLAFRFFFYQYGIVYHLDIAHFSKSLLVYGLSWVVMVTVL
Full Sequence
Protein Sequence     Length: 2500     Download
MDRVEEVFGE VDDWEIYEKV IREHSHGRAL DALHDEDGFY KDGIDADETD GDNVDEDDDT    60
DGYGADKDGT DGDGADEDGV DGNSNFHKCR QPLCKSRLSL SGSRQSPRGS RRVKASPLAA    120
IKEFKVLHVS NLVLSCLNWI KVNDDRDLEA TAAIGIGYDL KSKTSKVVRI LSIGHDCLDD    180
DRARTHPPKA EVYSLVTDCW KEISTDSLVK DTVEALPRAK RQARNFICCR GIIYWCAMKS    240
PREYKVCFTP DEDEEEDFEI PKAVIDVCGF GGDGYSEVKH VDARAILGWV TYWEAAPELP    300
ETKPESLSIS PLLLEKKKKM ILLESILEKG NCFRLDLQLL ILYIALAVFN GALAAIAFSQ    360
LVRIHMRNQQ IGWTRQKVLH LMIGCSNLGY FLYFTSTLIA TCKQWFCWSN VCGFILMAYP    420
EVLFLAAFLL VLSFWVDLCH QANDEEEEDD DSNIQHALLV NSQNKHHSSN TDGHRICCSF    480
PSIHVGSHQK FAIAVVGFVL ILMMSFSVMI WIGVGKNSID SSVVAQVYED FLAFTVLFLG    540
GGLGCYGILL LRKLRKVRSE KASSEMWKVG GLAVASVVCF TSSALVALLT DKPLYDPWSL    600
KKAYGGKALI FLMLYYFIGS WVPSAFVLWF MRELPPPITN RRREQSTTIA FISHAGVGPQ    660
HPRQWATVTS SNNQTWILPT FAFGSCTELY RRTARGTFCN ECFPSLQKLI ILVCKPMCYP    720
CYSLYLHVAV IPAALNLAHN ATCSAEAAED IGIAKTALKF PFSSLSTTPE SVRRLVLKEM    780
ASSSGTKAVD SSGPQRSLSR GMTRMSTRVV DFPTEGDDAL DSGVVPSCLA SIAPIFRVAN    840
EIEKDNPRVA YLCRFHGFEK AHKMDPTSSG RGVRQFKTHL LHRLEKDERD TKHQVAKSDT    900
NEIKLYYHEF YEKNIKDGEY TKKPEEMARN CQIATVLYDV LRTVVPANQI DKQIKAALRA    960
LQNVDNLPMP RMHFKPTNPD DKSTMPTERI KPVNDILDWL SAIFGFQKGN VANQREHLIL    1020
LLANIDVRHR SLENYTELNS ATVQHLMEKF FKNYRSWYNY LHSKSNLRFP EGFHRQQLEL    1080
IYIALYLLIW GEASNVRFMP ECLCYIFHNM ANEVYGILNS NAHHVSGETY QTVAHDEESF    1140
LRDVIAPIYG VLFKEAKRNK LGKASHSRWR NYDDLNEYFW SDKCFKLGWP MDPKADFFRH    1200
SDVRQPANER TNQATGGRRK PKTNFVEVRT FLHLYRSFDR MWIFFILALQ AMIIVAWGPS    1260
GYVTSIFDAA VFKSVLSIFM TYAFLNLLQA TLDIILSWNA WKSLKFTQIL RYLLKFAVAV    1320
VWAVVLPIGY SSSMQNPTGL LKFFSSWTRD WRNQSFYNYA VAIYMVPNIL AAMLFFLPPL    1380
RRHIERSNWR IVTLFMWWAQ ASFSHWSNQS SCSLPKLYVG RGMHEDVFSL LKYTLFWIML    1440
LISKLAFSYY VEISPLVAPT KLIMDMSITN YQWHEFFPNA THNIGVVIAI WAPIVLVYFM    1500
DAQIWYAIFS TLFGGIHGAF SHLGEIRTLG MLRSRFESVP SAFSDRLMPS SEIKDAKKKK    1560
HLVWPPFLLA SKIPIALDMA KDFTGKSDED LFKKIMNDDY MYSAVIECYE TLRDIIFGLL    1620
EDEADKMIVR QICYEVDSSI QQQKFLFNFR MSGLPFLSER LEKFLKLLLA EDENVDNYLR    1680
QIINVLQDIM EIITQDVMMN GHEILEEAHY IEGQNVKKEQ RFEKINIYLA QNPSWREKVV    1740
RLHLLLTVKE SAINVPQNLD ARRRITFFAN SLFMNMPNAP KVRDMLSFSV LTPYYKEDVL    1800
YSDDELNKEN EDGISILFYL QKIYPDEWTN FQDRINEHKN EYSDKDKSEL IRQWVSYRGQ    1860
TLSRTVRGMM YYRKALDLQC ILETAGDGGV YGGYPAQILS EIDEKDILDR AQALADLKFT    1920
YVVSCQIYGE QKKSSESRDK SCYTNILKLM LTYPSLRVAY IDTREETVNG KSQKIYFSVL    1980
VKGGDKWDEE IYRIKLPGPP TVIGEGKPEN QNHAIVFTRG EALQTIDMNQ DNYFEEAFKM    2040
RNVLEEFRKP RRGQRKPTIL GLREHIFTGS VSSLAWFMSN QETSFVTIGQ RILANPLRVR    2100
FHYGHPDIFD RLFHITRGGI SKASKVINLS EDIFSGYNSV LRGGFITHHE YIQVGKGRDV    2160
GMNQISLFEA KVANGNGEQT LSRDVYRLGR RFDFYRMLSF YFTTVGFYFS SMADILGVQY    2220
FGNVFLFDTD TILFQVTVLT VYVFLYGRLY MVMSGLESEI LDSPAIHQTK AFEEALATQS    2280
VFQLGLLLVL PMVMEIGLEK GFRTALGDFI IMQLQLASVF FTFQLGTKAH YYGRTILHGG    2340
SKYRATGRGF VVFHAKFADN YRLYSRSHFV KGLELLILLI VYGVYGNAYR SSNLYFFITF    2400
SMWFLVASWL FAPFIFNPSS FDWQKTVDDW TDWKRWMGNR GGIGISPDKS WESWWDEEQE    2460
HLKHTIIRGR ILEIMLAFRF FFYQYGIVYH LDIAHFSKSL                          2520
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam04652DUF6057.0e-5830943125+
pfam06454DUF10849.0e-9351649303+
pfam14288FKS1_dom13.0e-4810901192104+
pfam02364Glucan_synthase017552507848+
Gene Ontology
GO TermDescription
GO:00001481,3-beta-D-glucan synthase complex
GO:00038431,3-beta-D-glucan synthase activity
GO:0006075(1->3)-beta-D-glucan biosynthetic process
GO:0016020membrane
Transmembrane Domains
StartEnd
339358
378400
413435
491513
528550
570589
609631
12411263
12781300
13121334
13561378
14351457
14771499
15041526
22052227
22342256
22762298
23052327
23672389
23942416
24712493
25002522
25372559
25642584
26042626
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_056_00094.1Aquca_014_00906.1Aquca_019_00181.4Aquca_019_00181.3Aquca_019_00181.1
Aquca_016_00166.1Aquca_019_00181.2Aquca_084_00016.4Aquca_084_00016.3Aquca_084_00016.2
Aquca_084_00016.1Aquca_022_00132.2Aquca_022_00132.1Aquca_014_00908.4Aquca_014_00908.3
Aquca_014_00908.2Aquca_014_00908.1Aquca_014_00908.5Aquca_008_00266.1Aquca_039_00091.4
Aquca_039_00091.2Aquca_039_00091.1Aquca_039_00091.3Aquca_056_00094.2
Arabidopsis lyrata340908482666470669899601907409
878725482124490214490142897726
325786
Arabidopsis thalianaAT3G07160.1AT2G36850.1AT1G06490.1AT4G03550.1AT2G13680.1
AT1G05570.2AT1G05570.1AT4G04970.1AT3G59100.1AT2G31960.2
AT2G31960.1AT5G13000.1AT5G13000.2AT3G14570.2AT3G14570.1
AT5G36870.1
Brachypodium distachyonBradi1g51757.1Bradi1g77247.2Bradi1g77247.1Bradi1g47427.1Bradi2g50140.1
Bradi3g60790.2Bradi3g60790.1Bradi1g29622.1Bradi1g76617.1Bradi2g46250.1
Bradi2g40460.1Bradi3g09317.1Bradi2g40430.1
Brassica rapaBra005239Bra029628Bra001239Bra040364Bra015504
Bra034218Bra032416Bra037213Bra029541Bra015436
Bra003364Bra023386Bra008864Bra005624Bra027328
Carica papayaevm.model.supercontig_42.151evm.model.supercontig_189.7evm.model.supercontig_25.167evm.model.supercontig_858.3evm.model.supercontig_2050.2
evm.model.supercontig_3407.1evm.model.supercontig_50.100evm.model.supercontig_4.57
Capsella rubellaCarubv10022498mCarubv10022499m
Citrus clementinaCiclev10014066mCiclev10018457mCiclev10018456mCiclev10000018mCiclev10018223m
Ciclev10030477mCiclev10030476mCiclev10014015mCiclev10030481mCiclev10030478m
Ciclev10030495mCiclev10024186mCiclev10030599mCiclev10030560mCiclev10030796m
Citrus sinensisorange1.1g000946morange1.1g000813morange1.1g000382morange1.1g000253morange1.1g000219m
orange1.1g000179morange1.1g000260morange1.1g000273morange1.1g000180morange1.1g000261m
orange1.1g045737morange1.1g000259morange1.1g000258morange1.1g001004morange1.1g000585m
orange1.1g000171morange1.1g000349morange1.1g000165morange1.1g001473morange1.1g000389m
orange1.1g000385morange1.1g040336morange1.1g000763m
Cucumis sativusCucsa.157510.4Cucsa.157510.3Cucsa.157510.2Cucsa.157510.1Cucsa.142920.1
Cucsa.249900.1Cucsa.119100.1Cucsa.126670.1Cucsa.239610.1Cucsa.049980.10
Cucsa.142930.1Cucsa.049980.1Cucsa.058220.1Cucsa.058230.1
Eucalyptus grandisEucgr.B00160.1Eucgr.B03640.2Eucgr.B03640.1Eucgr.I00208.1Eucgr.K01028.4
Eucgr.K01028.3Eucgr.K01028.2Eucgr.K01028.1Eucgr.D00621.1Eucgr.A01821.1
Eucgr.K01027.1Eucgr.D00622.1Eucgr.J00836.1Eucgr.J00827.1Eucgr.F01403.1
Eucgr.A01827.1Eucgr.A02008.1Eucgr.A01817.1Eucgr.A01994.2Eucgr.A01994.1
Eucgr.A02010.1Eucgr.J00836.2Eucgr.A01997.1
Fragaria vescamrna09912.1-v1.0-hybridmrna17912.1-v1.0-hybridmrna17710.1-v1.0-hybridmrna02397.1-v1.0-hybridmrna24411.1-v1.0-hybrid
mrna26782.1-v1.0-hybridmrna28728.1-v1.0-hybrid.526.840mrna28728.1-v1.0-hybrid.526.840
Glycine maxGlyma06g18216.1Glyma04g36725.1Glyma20g38860.1Glyma10g44150.1Glyma05g32500.4
Glyma05g32500.3Glyma05g32500.2Glyma08g16660.1Glyma04g39120.2Glyma04g39120.1
Glyma13g37290.2Glyma08g42150.3Glyma08g42150.2Glyma08g42150.1Glyma18g12870.3
Glyma18g12870.2Glyma18g12870.1Glyma15g08020.3Glyma15g08020.2Glyma15g08020.1
Glyma15g42330.4Glyma15g42330.3Glyma15g42330.2Glyma18g53823.1Glyma08g47670.1
Glyma08g47670.2Glyma18g13105.9Glyma18g13105.8Glyma18g13105.7Glyma18g13105.6
Glyma18g13105.10Glyma18g13105.3Glyma18g13105.2Glyma18g13105.1Glyma18g13105.5
Glyma18g13105.4Glyma15g39420.2Glyma13g33560.1Glyma05g32500.6Glyma05g32500.5
Glyma08g42110.1Glyma06g44770.3Glyma06g44770.2Glyma13g31310.1Glyma06g44770.4
Glyma10g44150.2Glyma08g16715.1Glyma06g15860.1.320.682Glyma06g15860.1.320.682Glyma08g16730.2
Gossypium raimondiiGorai.004G018200.3Gorai.004G018200.1Gorai.004G018200.2Gorai.003G109000.6Gorai.003G109000.1
Gorai.003G109000.2Gorai.003G109000.3Gorai.003G109000.4Gorai.011G120300.1Gorai.005G201500.2
Gorai.005G201500.1Gorai.011G119900.1Gorai.013G075600.1Gorai.004G092500.3Gorai.004G092500.2
Gorai.004G092500.1Gorai.011G096900.3Gorai.011G096900.1Gorai.004G092600.3Gorai.004G092600.1
Gorai.009G169700.3Gorai.009G169700.2Gorai.009G169700.1Gorai.012G187400.3Gorai.012G187400.2
Gorai.012G187400.1Gorai.004G092600.2Gorai.004G092600.4Gorai.012G040000.2Gorai.012G040000.1
Gorai.005G042700.1Gorai.005G043100.1Gorai.012G128700.1Gorai.007G334800.1Gorai.007G334800.2
Gorai.003G109000.5
Linum usitatissimumLus10014796Lus10032463Lus10039828Lus10000266Lus10031648
Lus10033689Lus10001424Lus10001056Lus10003920Lus10039199
Lus10037469Lus10013744Lus10033483Lus10007327Lus10030030
Lus10042478Lus10020893Lus10020750Lus10040891.301.669Lus10040891.301.669
Lus10002096Lus10002097
Malus domesticaMDP0000174437MDP0000286691MDP0000245319MDP0000275961MDP0000915307
MDP0000229527MDP0000230907MDP0000203763MDP0000321472MDP0000220467
MDP0000308574MDP0000198973MDP0000230621MDP0000212172.415.839MDP0000212172.415.839
MDP0000372473MDP0000310065MDP0000213931MDP0000218486.624.863MDP0000218486.624.863
MDP0000218486.624.863
Manihot esculentacassava4.1_001919mcassava4.1_031653mcassava4.1_029201mcassava4.1_000111mcassava4.1_000342m
cassava4.1_000112mcassava4.1_000082mcassava4.1_026004mcassava4.1_002527mcassava4.1_003374m
cassava4.1_003342mcassava4.1_006866mcassava4.1_028751mcassava4.1_033421m
Medicago truncatulaMedtr4g078220.1Medtr3g047390.1Medtr7g005950.1Medtr1g116370.1AC235753_1023.1
Medtr1g116470.1.521.981Medtr1g116470.1.521.981Medtr1g116470.1.228.504Medtr1g116470.1.228.504
Mimulus guttatusmgv1a000080mmgv1a000075mmgv1a000084mmgv1a000082mmgv1a000070m
mgv1a000067mmgv1a000108mmgv1a024191mmgv1a000066mmgv1a000106m
mgv1a000068m
Oryza sativaLOC_Os06g08380.1LOC_Os02g58560.1LOC_Os01g55040.1LOC_Os06g51270.1LOC_Os03g03610.3
LOC_Os03g03610.2LOC_Os03g03610.1LOC_Os02g58560.3LOC_Os02g14900.1LOC_Os01g34930.1
LOC_Os01g48200.1LOC_Os01g34890.1LOC_Os01g34880.1
Panicum virgatumPavirv00009928mPavirv00009617mPavirv00009495mPavirv00057448mPavirv00022973m
Pavirv00045342mPavirv00015084mPavirv00020404mPavirv00041942mPavirv00010502m
Pavirv00026821mPavirv00007196mPavirv00061397mPavirv00045035mPavirv00040188m
Pavirv00056028mPavirv00049749mPavirv00048524mPavirv00058599m
Physcomitrella patensPp1s88_136V6.1Pp1s160_88V6.1Pp1s40_186V6.2Pp1s67_234V6.1Pp1s67_70V6.1
Pp1s145_49V6.1Pp1s18_300V6.2Pp1s199_13V6.1Pp1s13_132V6.1Pp1s13_432V6.1
Pp1s379_24V6.1Pp1s66_72V6.1
Phaseolus vulgarisPhvul.007G004900.2Phvul.007G004900.1Phvul.007G004900.3Phvul.002G272000.1Phvul.009G150300.2
Phvul.009G150300.1Phvul.011G113800.1Phvul.006G185600.2Phvul.006G185600.1Phvul.006G032100.1
Phvul.006G031900.1Phvul.005G103600.1Phvul.008G002300.1Phvul.005G040900.2Phvul.007G005100.1
Phvul.005G040900.1Phvul.005G062500.1Phvul.009G169400.1
Picea abiesMA_10428413g0040MA_826577g0010MA_960362g0010MA_10426974g0030MA_735748g0010
MA_6205g0020MA_10426974g0020MA_10430560g0010MA_10431062g0010MA_229544g0010
MA_10434444g0010MA_10431631g0010
Populus trichocarpaPotri.015G089300.1Potri.001G011900.1Potri.005G058300.2Potri.005G058300.1Potri.013G131300.1
Potri.001G230000.9Potri.001G230000.8Potri.001G230000.7Potri.001G230000.6Potri.001G230000.5
Potri.001G230000.4Potri.001G230000.3Potri.001G230000.2Potri.001G230000.17Potri.001G230000.16
Potri.011G052400.6Potri.011G052400.5Potri.011G052400.4Potri.011G052400.3Potri.011G052400.2
Potri.011G052400.1Potri.002G058700.3Potri.002G058700.2Potri.002G058700.1Potri.001G012200.3
Potri.001G012200.1Potri.001G012200.2Potri.005G203500.2Potri.005G203500.1Potri.003G214200.2
Potri.003G214200.1Potri.011G095100.2Potri.011G095100.1Potri.001G230000.10Potri.001G230000.18
Potri.001G012200.5Potri.001G012200.4Potri.005G203500.3Potri.001G230000.11Potri.001G230000.12
Potri.001G230000.13
Prunus persicappa000071mppa000167mppa000077mppa000074mppa001863m
ppa000121mppa000112mppa002267mppa000073mppa003008m
ppa000306m
Ricinus communis30147.m01381228035.m00035829691.m00028229983.m00319129734.m000419
28035.m00035929759.m00028130226.m00202329983.m00319229851.m002416
Setaria italicaSi033860mSi034369mSi034352mSi008368mSi016068m
Si016067mSi000021mSi000023mSi000022mSi000017m
Si033956mSi033893mSi033872mSi016150mSi000059m
Selaginella moellendorffii133452439692163802267830177798
449402
Sorghum bicolorSb10g005550.1Sb04g038510.1Sb10g030970.1Sb01g048630.1Sb03g023490.1
Sb03g030800.1Sb03g034880.1Sb04g008830.1
Thellungiella halophilaThhalv10019878mThhalv10016126mThhalv10006529mThhalv10022518mThhalv10028360m
Thhalv10028359mThhalv10006533mThhalv10006528mThhalv10016125mThhalv10012412m
Thhalv10005734mThhalv10019876mThhalv10029222m
Vitis viniferaGSVIVT01025370001GSVIVT01007560001GSVIVT01026489001GSVIVT01001361001GSVIVT01020854001
GSVIVT01025362001GSVIVT01000622001GSVIVT01005204001GSVIVT01020548001.494.863GSVIVT01020548001.494.863
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)