y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna28878.1-v1.0-hybrid
FamilyCBM57
Protein PropertiesLength: 917 Molecular Weight: 102254 Isoelectric Point: 6.3871
ChromosomeChromosome/Scaffold: 3 Start: 6018250 End: 6028905
Descriptionhercules receptor kinase 2
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM572874417.3e-22
  YRLNVGGSEVSPSQDSDLWRKWEVDTSYMITANAGLEIKNSSNITYSSVNESSVAPLLVYESARTMSNNEVLEKRFNMSWKFEVDPDFDYLVRLHFCELV
  FDKANQRIFRVYINNRTAADNFNVFVRAGGMNKAYHQDFFDVVSSKVKTLWIQLG
Full Sequence
Protein Sequence     Length: 917     Download
MEKKRIERGA NREEEGEDGE ELQKRRRRQK EKKEAEAERE DDVVRMYNCY DLQADWVCGV    60
LKRKSQVGFK NQSLFIAVMV MKTCEAQSRS FLINCGTNSS VTVSGRKWVG DLTPNNNITL    120
SSNGIDAFTD IKSVDDSTYG VLYKTARMFS SSLNYTFQGV RGDYFVRLHF SPFSFDDYNV    180
NVSSFGVLAN GLKLVEKFVV PGEISQKNAY LQSSGSNLTS SLVKEYVLAI NRDALVIEFI    240
PDKEKFGFIN AIEIVPATEE LFAGSASKVG GNGANVNVSW QGIETMYRLN VGGSEVSPSQ    300
DSDLWRKWEV DTSYMITANA GLEIKNSSNI TYSSVNESSV APLLVYESAR TMSNNEVLEK    360
RFNMSWKFEV DPDFDYLVRL HFCELVFDKA NQRIFRVYIN NRTAADNFNV FVRAGGMNKA    420
YHQDFFDVVS SKVKTLWIQL GPDTAVGAAG TDALLNGLEI FKISRNGNLA FVDNYESSAN    480
SSKASSKTAI LWGAIGAGLA SVAILVTIVY YFCKCRREKL SDTKTTPPGW RPLFLVNSTV    540
NAKGSAGSKN QHGSVAPTRA GKRFLLPEIR AATNNFNESL VIGVGGFGKV YKGEIEDGTL    600
VAIKRSNPQS QQGLAEFETE IEMLSKLRHR HLVSLIGFCD EQNEMILVYE YMANGTLRSH    660
LFGSELPPLT WKQRVEACIG AARGLHYLHT GADRGIIHRD VKTTNILLDE NFVAKMSDFG    720
LSKTGPALDH THVSTAVKGS FGYLDPEYFR RQQLTEKSDV YSFGVVLFEA VCSRPVINPT    780
LPKDQINLAE WAMKWQRHRS LETIIDTHLE GNYCPESLKK FGDIAEKCLA DEGKSRPTMG    840
EVLWHLEYVL QLHEAWLRKN AGEHSFTSSQ GFGGLAVDEA EEREATSFDE ETGCSRESTS    900
RGFNESTTEG VEMVRK*                                                   960
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam07714Pkinase_Tyr3.0e-51581846279+
smart00219TyrKc4.0e-52581846272+
smart00221STYKc4.0e-53581846275+
cd00192PTKc3.0e-53581847289+
pfam12819Malectin_like5.0e-5893463385+
Gene Ontology
GO TermDescription
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0006468protein phosphorylation
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2qkw_B056385528319A Chain A, Structural Basis For Activation Of Plant Immunity By Bacterial Effector Protein Avrpto
PDB3hgk_D056385528319E Chain E, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto
PDB3hgk_C056385528319E Chain E, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto
PDB3hgk_B056385528319E Chain E, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto
PDB3hgk_A056385528319E Chain E, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto
Transmembrane Domains
StartEnd
490512
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_026_00352.1
Brassica rapaBra032404
Citrus clementinaCiclev10014250m
Citrus sinensisorange1.1g047215m
Eucalyptus grandisEucgr.K01945.1
Malus domesticaMDP0000843097
Manihot esculentacassava4.1_030005m
Panicum virgatumPavirv00014838m
Populus trichocarpaPotri.011G164700.1Potri.001G467000.1
Setaria italicaSi028931m
Vitis viniferaGSVIVT01021662001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny