y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna28904.1-v1.0-hybrid
FamilyGH29
Protein PropertiesLength: 572 Molecular Weight: 64264.7 Isoelectric Point: 6.3781
ChromosomeChromosome/Scaffold: 3 Start: 16763429 End: 16766669
Descriptionalpha-L-fucosidase 1
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH29993950
  QLQWQLGHMAMFLHFGPNTFTDSEWGTGHVDPSVFNPTNLNATQWVQVAKDSGFSRVILTAKHHDGFCLWPTDYTNYSVSSSPWRNGGGDVVGELAKAAK
  DAGIGLGLYLSPWDRHEQCYGNTLEYNEFYMGQMTELLTRYGNIKEVWLDGAKGEGEKDMDYFFDSWFSLIHQHQPGAVIFSDAGPDTRWVGDEAGVAGS
  TCWSLFNRSSAKIGDTDFQYSRGGDPFGHDWVPAECDVSIRPGWFWHSSQVPKSARTLLELYCKSVGRNCLLLLNVPPNSSGLISAEDIEVLKEFSE
Full Sequence
Protein Sequence     Length: 572     Download
MWTCQQPLYF ASEFGVNLPK SKEATQPLQL HLSLFESLSL THIMIMKNKK NTHTPIPSSI    60
PRLHLLLLLS LSLSSTSCSS SLLKKPPPLP ILPLPSAPQL QWQLGHMAMF LHFGPNTFTD    120
SEWGTGHVDP SVFNPTNLNA TQWVQVAKDS GFSRVILTAK HHDGFCLWPT DYTNYSVSSS    180
PWRNGGGDVV GELAKAAKDA GIGLGLYLSP WDRHEQCYGN TLEYNEFYMG QMTELLTRYG    240
NIKEVWLDGA KGEGEKDMDY FFDSWFSLIH QHQPGAVIFS DAGPDTRWVG DEAGVAGSTC    300
WSLFNRSSAK IGDTDFQYSR GGDPFGHDWV PAECDVSIRP GWFWHSSQVP KSARTLLELY    360
CKSVGRNCLL LLNVPPNSSG LISAEDIEVL KEFSELRRSI FSQNLAKDAK IRASSTRGSA    420
NNSWFNPYNV VEEGFHSYWA PEENQSNWVL YFDLQELVSF NILLVEEPIH MGQRVIKFHL    480
QILNENGEWN KVTNGTTVGY RRLLQFPIVK SRNLRFVIEK SRAEPLISYL GLYMDPFSTL    540
SNISDSTTQT SINSSQILPH IDFNHSQIAV L*                                  600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam01120Alpha_L_fucos5.0e-37109393320+
smart00812Alpha_L_fucos2.0e-39133393282+
COG3669COG36692.0e-65101533448+
Gene Ontology
GO TermDescription
GO:0004560alpha-L-fucosidase activity
GO:0005975carbohydrate metabolic process
GO:0007155cell adhesion
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ues_B09552819471A Chain A, Crystal Structure Of Alpha-1,34-Fucosidase From Bifidobacterium Longum Subsp. Infantis Complexed With Deoxyfuconojirimycin
PDB3ues_A09552819471A Chain A, Crystal Structure Of Alpha-1,34-Fucosidase From Bifidobacterium Longum Subsp. Infantis Complexed With Deoxyfuconojirimycin
PDB3mo4_B09552821473A Chain A, The Crystal Structure Of An Alpha-(1-3,4)-Fucosidase From Bifidobacterium Longum Subsp. Infantis Atcc 15697
PDB3mo4_A09552821473A Chain A, The Crystal Structure Of An Alpha-(1-3,4)-Fucosidase From Bifidobacterium Longum Subsp. Infantis Atcc 15697
PDB3uet_B09552819471A Chain A, Crystal Structure Of Alpha-1,34-Fucosidase From Bifidobacterium Longum Subsp. Infantis D172aE217A MUTANT COMPLEXED WITH LACTO-N- Fucopentaose Ii
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_013_00507.1Aquca_062_00017.1
Arabidopsis lyrata481700
Arabidopsis thalianaAT2G28100.1
Brachypodium distachyonBradi4g35500.1Bradi5g18220.1
Brassica rapaBra034388
Carica papayaevm.model.supercontig_65.36evm.model.supercontig_3.250
Capsella rubellaCarubv10023050m
Citrus clementinaCiclev10028463m.194.266Ciclev10004832mCiclev10028210mCiclev10028463m.194.266Ciclev10028463m.51.191
Ciclev10028463m.51.191
Citrus sinensisorange1.1g011170morange1.1g047217m
Cucumis sativusCucsa.385790.1Cucsa.193300.1
Eucalyptus grandisEucgr.J00379.2Eucgr.J00379.1Eucgr.J00367.1Eucgr.A02862.1Eucgr.A02861.1
Fragaria vescamrna13375.1-v1.0-hybridmrna13376.1-v1.0-hybrid
Glycine maxGlyma12g30151.1Glyma13g39750.2Glyma10g38670.2Glyma20g29080.1Glyma10g38670.1
Gossypium raimondiiGorai.004G231200.1Gorai.008G282700.1
Linum usitatissimumLus10016140Lus10027390Lus10031681Lus10021427
Malus domesticaMDP0000166406MDP0000271120MDP0000917175MDP0000295518
Manihot esculentacassava4.1_032976mcassava4.1_006636mcassava4.1_007875mcassava4.1_021316m
Medicago truncatulaMedtr1g102230.1Medtr2g095700.1
Mimulus guttatusmgv1a004219mmgv1a005268m
Oryza sativaLOC_Os09g34920.1LOC_Os04g47280.1
Panicum virgatumPavirv00068426mPavirv00016802mPavirv00061161m
Physcomitrella patensPp1s55_131V6.2Pp1s55_131V6.1
Phaseolus vulgarisPhvul.007G063900.1Phvul.005G131200.1
Picea abiesMA_16736g0010MA_171759g0010MA_8122188g0010
Populus trichocarpaPotri.015G133500.1Potri.009G006900.1Potri.012G131400.1
Prunus persicappa023537mppa005337m
Ricinus communis30147.m01415529589.m001240
Setaria italicaSi009874mSi029623m
Selaginella moellendorffii103164236749.37.121236749.37.121415432412246
236951112167158775103375431829
236749.167.333236749.167.333431838103154
Sorghum bicolorSb06g025200.1Sb02g030220.1
Thellungiella halophilaThhalv10016493mThhalv10016468m
Vitis viniferaGSVIVT01018468001.39.381GSVIVT01018468001.39.381GSVIVT01018468001.542.842GSVIVT01018468001.542.842GSVIVT01031495001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)