y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna29072.1-v1.0-hybrid
FamilyCE10
Protein PropertiesLength: 1249 Molecular Weight: 137281 Isoelectric Point: 5.3704
ChromosomeChromosome/Scaffold: 4 Start: 1184534 End: 1199160
Descriptionacylaminoacyl-peptidase-related
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE10101312319.9e-26
  IDPLIVILHGGPHSVYLTSFSKNLAFLSSIGFNLLLVNYRGSVGFGEEALQSLPGKVGSQDVNDVLVAIDHVIDLGLASPSKIAVLGGSHGGFLTTHLIG
  QAPEKFAAACARNPVCNLALMVGTTDIPDWCYVEAYGSEGKNIYSEAPSAEDLALFHSKSPISHILKVKTPTLFLLGAQDLRVPISTGLQYARALKDKGV
  AVKVIMFPNDIHPIDRPQS
Full Sequence
Protein Sequence     Length: 1249     Download
MLAAYDKPVG SLGFGEEALQ SLPGNIGSQD VNDIPVAIDH VIDMGLASPS KMAVLGGSHG    60
GLLTTHLIGQ APEKFFAVAT RNPACNLALM VGTTDIPDWC YVEAYGTEGK NRYTEAPSAE    120
HLASFTANLQ FHISQRPKHP PFFSWVPKIS AFQFVADCKA LKEKGVAVKV IVFPNDNHPI    180
DRPQFDFESF LNIGVWFKSL ELLPYDPEIE RTIRKKIEKP DSQITMGENL ETKTLREYFA    240
PITTNSPSCI VLPNTTAAHF ELKPQILQLL PNFRGLDRED PYMHVKEFLD ICSTFKFQNF    300
SDESVRLRLF PFSLKDKAKG WLNSQPPGSI TSWDELSNRH MIESMKGGAF LSLRDDEAYE    360
FLENLSENSQ QWDFSNQYDR QVKEPKRGGM YEVRSGSDLE IKIESLSRKV EALALDKTMS    420
SVNQVQSEGC SLCASPMHSA QTCPSMCGYS ESHPEQINAL NNFRKPFAPQ SNPQFAAPQP    480
QQSSLEESLQ KFMQISEPSS SLNSHEQVQS IATLRSGKQV DNKVQMPDLD EDAPTNKSKD    540
GEVPISSDNH SSSVPKIQTF PVVEQPSSIK DPLEACLVHF GADFDFDKSI KEVNALLDSV    600
PLIDSANWKS KGISWNSDET LIAYVAEEPS PSKPTFTFQG YKKGSSTDKE FGNWKGQGEW    660
EEEWGETYAG KRQPALFVIN VNSGETQAVK GIEKRLSVGQ VVWAPPISGS HQYLVFVGWS    720
ADTRKLGMVY CYNRPCALYA VKAPLYGSEA DGQEIKDNST EDCPVVNLTQ SISSAFFPRF    780
SPDGKLLLFL SARSSVDSGA HSATDSLHKF DWPVDGVPCS SMEVVDVVTR GGAKGIHTQQ    840
LFECWYVVTI PVVMCADDGC FPGLYCSSFL TNPWLSDGCT MIMSSFWGSC QVILSVNVLS    900
GEVSRISPTD SNSWNVLSLD GDNIVTVSSS PVHVPHIKYG FLDKESKSTA WNWLDVPSPT    960
NECSGKVKSL LSSLQFSIMK IPVKDVSDSL TKGARKPFEA IFVSSKAKRT DPIDPLIVIL    1020
HGGPHSVYLT SFSKNLAFLS SIGFNLLLVN YRGSVGFGEE ALQSLPGKVG SQDVNDVLVA    1080
IDHVIDLGLA SPSKIAVLGG SHGGFLTTHL IGQAPEKFAA ACARNPVCNL ALMVGTTDIP    1140
DWCYVEAYGS EGKNIYSEAP SAEDLALFHS KSPISHILKV KTPTLFLLGA QDLRVPISTG    1200
LQYARALKDK GVAVKVIMFP NDIHPIDRPQ SDFESFLNIG VWFKKYLF*                1260
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG1506DAP23.0e-1010184181+
pfam00326Peptidase_S94.0e-1110199199+
pfam12697Abhydrolase_67.0e-1210171221205+
pfam00326Peptidase_S92.0e-3610311247220+
COG1506DAP28.0e-4410151247233+
Gene Ontology
GO TermDescription
GO:0006508proteolysis
GO:0008152metabolic process
GO:0008236serine-type peptidase activity
GO:0016787hydrolase activity
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4hxf_B1e-1810151224379578B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB4hxe_B1e-1810151224379578B Chain B, Pyrococcus Horikoshii Acylaminoacyl Peptidase (uncomplexed)
PDB4hxg_L2e-1810151224379578A Chain A, Pyrococcus Horikoshii Acylaminoacyl Peptidase (orthorhombic Crystal Form)
PDB4hxg_K2e-1810151224379578A Chain A, Pyrococcus Horikoshii Acylaminoacyl Peptidase (orthorhombic Crystal Form)
PDB4hxg_J2e-1810151224379578A Chain A, Pyrococcus Horikoshii Acylaminoacyl Peptidase (orthorhombic Crystal Form)
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00583.4Aquca_017_00583.3Aquca_017_00583.2Aquca_017_00583.1Aquca_015_00163.1
Arabidopsis lyrata915409859721
Arabidopsis thalianaAT4G14570.1AT5G36210.1
Brachypodium distachyonBradi3g26780.4Bradi3g26780.3Bradi3g26780.2Bradi3g26787.1Bradi1g45890.1
Brassica rapaBra039731Bra036867Bra037063Bra030822
Capsella rubellaCarubv10006608mCarubv10013057mCarubv10012695mCarubv10013077mCarubv10004231m
Chlamydomonas reinhardtiiCre05.g241650.t1.3Cre10.g423300.t1.1
Citrus clementinaCiclev10004377mCiclev10004325mCiclev10003676m
Citrus sinensisorange1.1g005093morange1.1g004149morange1.1g004141morange1.1g003363morange1.1g004816m
orange1.1g004757morange1.1g004756morange1.1g004735m
Cucumis sativusCucsa.386660.1Cucsa.123480.1Cucsa.123460.1
Eucalyptus grandisEucgr.H00222.1Eucgr.H00221.1Eucgr.F00026.5Eucgr.F00026.4Eucgr.F00026.3
Eucgr.F00026.2Eucgr.F00026.1Eucgr.F00028.1Eucgr.F00027.2Eucgr.F00027.1
Eucgr.L02208.1Eucgr.F00027.3Eucgr.F00025.1
Fragaria vescamrna32579.1-v1.0-hybridmrna09045.1-v1.0-hybridmrna09044.1-v1.0-hybrid
Glycine maxGlyma10g00350.1Glyma10g00320.1Glyma08g42730.1Glyma18g11480.3Glyma18g11480.2
Glyma18g11480.4
Gossypium raimondiiGorai.006G245500.5Gorai.006G245500.4Gorai.006G245500.3Gorai.006G245500.1Gorai.010G016900.1
Linum usitatissimumLus10039405Lus10015363Lus10032765Lus10021758
Malus domesticaMDP0000211874MDP0000304250MDP0000251803
Manihot esculentacassava4.1_002075mcassava4.1_031105mcassava4.1_005468m
Medicago truncatulaAC233668_48.1Medtr5g042400.2Medtr5g042400.1Medtr5g042410.1Medtr3g051310.1
Mimulus guttatusmgv1a001402mmgv1a001397mmgv1a002403m
Oryza sativaLOC_Os10g28020.3LOC_Os10g28020.1LOC_Os10g28020.2LOC_Os10g28030.2LOC_Os10g28030.1
LOC_Os06g11180.1
Panicum virgatumPavirv00008779mPavirv00061808mPavirv00015591mPavirv00045661mPavirv00003810m
Pavirv00003809m
Physcomitrella patensPp1s619_3V6.1Pp1s97_68V6.1Pp1s108_134V6.1Pp1s9_317V6.2Pp1s9_317V6.1
Pp1s139_36V6.2Pp1s139_36V6.1
Phaseolus vulgarisPhvul.007G279900.1Phvul.007G280000.1Phvul.006G042600.1Phvul.006G042700.1
Populus trichocarpaPotri.008G160400.1Potri.002G128700.9Potri.002G128700.8Potri.002G128700.7Potri.002G128700.6
Potri.002G128700.5Potri.002G128700.4Potri.002G128700.3Potri.002G128700.2Potri.002G128700.10
Potri.002G128700.1
Prunus persicappa001729mppa002365m
Ricinus communis29844.m00318230170.m01392428323.m000042
Setaria italicaSi034264mSi034356mSi006001mSi005937mSi005954m
Selaginella moellendorffii16830378836
Sorghum bicolorSb01g021970.4Sb01g021970.2Sb01g021970.1Sb01g021970.5Sb01g021960.1
Sb01g021970.3Sb10g007280.1Sb10g007270.1
Thellungiella halophilaThhalv10024477mThhalv10003712m
Vitis viniferaGSVIVT01018091001GSVIVT01009564001GSVIVT01009565001
Volvox carteriVocar20006950m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)