y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna29291.1-v1.0-hybrid
FamilyPL1
Protein PropertiesLength: 380 Molecular Weight: 42304.5 Isoelectric Point: 9.4951
ChromosomeChromosome/Scaffold: 5 Start: 19079133 End: 19080462
DescriptionPectin lyase-like superfamily protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
PL11043020
  DKKWITFQRDMKIKLEKPLLISSFTAIDGRGVNVHIAGNACLRVFKATNVIIHGLRIHHCKSQPPSTVMGPDGIVSLGGVDGDAIRLVTASKVWIDHNTL
  YECEDGLLDVTRGSTNVTISNNWFRDQDKVMLLGHDDGFFRDKNMKRQVLFPKHKGSQCFRIRHGYAHVVNNLYKEWTLYAIGGSMNPSVKSEANLFIA
Full Sequence
Protein Sequence     Length: 380     Download
MASQYCFVLV NAIILLCSLC PNLSSAKETK VLGLKMNAID GCWRWNPNWR SNRQQLAMCS    60
VGFAGKMSNN IGKDVVNYEV TDPSDNALNP QPGTLRYGAT MIKDKKWITF QRDMKIKLEK    120
PLLISSFTAI DGRGVNVHIA GNACLRVFKA TNVIIHGLRI HHCKSQPPST VMGPDGIVSL    180
GGVDGDAIRL VTASKVWIDH NTLYECEDGL LDVTRGSTNV TISNNWFRDQ DKVMLLGHDD    240
GFFRDKNMKR QVLFPKHKGS QCFRIRHGYA HVVNNLYKEW TLYAIGGSMN PSVKSEANLF    300
IASQQNKEVT WRKDIVSDSW KFYSKGDIFE NGASFVQTGQ GGAEPLYNKE QNFQVVDAKS    360
VRPLTRASGA LTCTKQSRC*                                                420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3866PelB2.0e-18124300194+
pfam00544Pec_lyase_C3.0e-44126300185+
smart00656Amb_all3.0e-55113303204+
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1pxz_B0373722346A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB1pxz_A0373722346A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB3vmw_A0.000000000212930082246A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB3vmv_A0.000000000212930082246A Chain A, Crystal Structure Of Pectate Lyase Bsp165pela From Bacillus Sp. N165
PDB1vbl_A0.0000000002122300128330A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47
Transmembrane Domains
StartEnd
726
Signal Peptide
Cleavage Site
26
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_035_00024.1Aquca_018_00074.1Aquca_015_00229.1
Arabidopsis lyrata487738881338
Arabidopsis thalianaAT5G09280.1AT1G30350.1
Brassica rapaBra009375Bra012756
Carica papayaevm.model.supercontig_42.185evm.model.supercontig_51.17
Capsella rubellaCarubv10002943mCarubv10006459m
Citrus sinensisorange1.1g041616m
Cucumis sativusCucsa.112490.1
Eucalyptus grandisEucgr.K02336.1
Glycine maxGlyma11g06761.1Glyma01g38540.1Glyma16g25710.2Glyma13g21880.2
Gossypium raimondiiGorai.010G196700.1Gorai.010G196900.1Gorai.010G197000.1Gorai.010G197100.1Gorai.010G197400.1
Gorai.008G271800.1Gorai.008G271900.1Gorai.010G197600.1Gorai.010G197500.1Gorai.004G231500.1
Gorai.010G196800.1Gorai.010G197300.1
Linum usitatissimumLus10031867Lus10031296
Malus domesticaMDP0000244018MDP0000233331MDP0000166129
Manihot esculentacassava4.1_026008mcassava4.1_024289mcassava4.1_025601mcassava4.1_023158m
Medicago truncatulaMedtr6g077900.1Medtr8g078350.1Medtr5g035840.1Medtr5g019060.1Medtr4g064420.1
Medtr3g030900.1Medtr8g078310.1Medtr8g078390.1Medtr8g078280.1Medtr5g019090.1
Medtr5g019170.1Medtr5g019160.1
Mimulus guttatusmgv1a021987m
Oryza sativaLOC_Os08g18970.1
Panicum virgatumPavirv00017566m
Physcomitrella patensPp1s385_14V6.1Pp1s45_65V6.1
Phaseolus vulgarisPhvul.004G101900.1Phvul.002G025800.1Phvul.004G098100.1Phvul.004G101600.1
Picea abiesMA_10433764g0010
Populus trichocarpaPotri.003G218200.1Potri.001G007400.1Potri.003G218200.2Potri.005G064500.2Potri.005G064500.1
Prunus persicappa016145mppa021860mppa016917mppa025917mppa016255m
Ricinus communis29596.m00070329743.m000300
Setaria italicaSi013945m
Selaginella moellendorffii88799
Sorghum bicolorSb03g036930.1
Thellungiella halophilaThhalv10015832m
Vitis viniferaGSVIVT01024239001
Zea maysAC233851.1_FGT011
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny