y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna29475.1-v1.0-hybrid
FamilyGH89
Protein PropertiesLength: 765 Molecular Weight: 86415.6 Isoelectric Point: 7.0028
ChromosomeChromosome/Scaffold: 7 Start: 7995354 End: 8004896
Descriptionalpha-N-acetylglucosaminidase family / NAGLU family
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH89987610
  PEIEIKGTTAVEIASGLHWYLKYFCGAHVSWDKTGGVQLASIPNTGSLPRVKDEGLKVQRPRGDIDSKKGWLNAWDSLIYEGINLPLAFTGQESIWQKVF
  LDFNISKGDLNDFFGGPAFLAWARMGNLHAWGGPLSQNWLDQQLILQKQILSRMLELGMTPVLPSFSGNVPATLKKIYPSANITRLGDWNTVNGDHRWCC
  TYLLDPSDPLFVEIGTAFIRRQVEGSCLTVQSTAVSSTVECLVTCDTFNENSPPTNDPAYISSLGAAVYKAMSKGDTDAVWLMQGWLFYSDSAFWKPPQM
  KALLHSIPFGKMIVLDLFADVKPIWNTSSQFYDTPYIWCLLHNFGGNLEMYGILDAISSGPVDARTSANSTMVGVGMCMEGIEHNPVIYELTSEMAFRSE
  KVPVKDWLRTYSRRRYGNAVRQVEEAWEILHRTIYNCTDGIADHNTDFIVKFPDWDPSLESDVINALQLFLDAGNDLSGSLTYRYDLVDLTRQVLSKLAN
  QVYVDAVTAFQKKDVKAYDVNSKKFVQLIKDIEGLLASDDNFLLGTWLESAKKLATSPMEKRQYEWNARTQVTMWYDTTKTNQSQLHDYANKFWSGLLES
  YYLPRASSYFHYLSKSLRENKDFEVEKWRTEWISFSNNWQAGTELYPVKAKGNALAISRALYKK
Full Sequence
Protein Sequence     Length: 765     Download
MSNLKTQFMI LLLVFVPIAV SVKPQQPVEA LLRRLDSKRS SASVQQAAAK ALLFRLLPTH    60
VDSFEFKIVG KNFECQDVCG GHSCFVINNH SPSRRYGPEI EIKGTTAVEI ASGLHWYLKY    120
FCGAHVSWDK TGGVQLASIP NTGSLPRVKD EGLKVQRPRG DIDSKKGWLN AWDSLIYEGI    180
NLPLAFTGQE SIWQKVFLDF NISKGDLNDF FGGPAFLAWA RMGNLHAWGG PLSQNWLDQQ    240
LILQKQILSR MLELGMTPVL PSFSGNVPAT LKKIYPSANI TRLGDWNTVN GDHRWCCTYL    300
LDPSDPLFVE IGTAFIRRQV EGSCLTVQST AVSSTVECLV TCDTFNENSP PTNDPAYISS    360
LGAAVYKAMS KGDTDAVWLM QGWLFYSDSA FWKPPQMKAL LHSIPFGKMI VLDLFADVKP    420
IWNTSSQFYD TPYIWCLLHN FGGNLEMYGI LDAISSGPVD ARTSANSTMV GVGMCMEGIE    480
HNPVIYELTS EMAFRSEKVP VKDWLRTYSR RRYGNAVRQV EEAWEILHRT IYNCTDGIAD    540
HNTDFIVKFP DWDPSLESDV INALQLFLDA GNDLSGSLTY RYDLVDLTRQ VLSKLANQVY    600
VDAVTAFQKK DVKAYDVNSK KFVQLIKDIE GLLASDDNFL LGTWLESAKK LATSPMEKRQ    660
YEWNARTQVT MWYDTTKTNQ SQLHDYANKF WSGLLESYYL PRASSYFHYL SKSLRENKDF    720
EVEKWRTEWI SFSNNWQAGT ELYPVKAKGN ALAISRALYK KYLM*                    780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam12971NAGLU_N2.0e-175214897+
pfam12972NAGLU_C5.0e-107503762272+
pfam05089NAGLU6.0e-146179498320+
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vcc_A018753142867A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB2vcb_A018753142867A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB2vca_A018753142867A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB2vc9_A018753142867A Chain A, Family 89 Glycoside Hydrolase From Clostridium Perfringens In Complex With 2-Acetamido-1,2-Dideoxynojirmycin
PDB4a4a_A018753165890A Chain A, Cpgh89 (E483q, E601q), From Clostridium Perfringens, In Complex With Its Substrate Glcnac-Alpha-1,4-Galactose
Signal Peptide
Cleavage Site
21
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_057_00157.1Aquca_039_00072.1Aquca_057_00157.2Aquca_057_00157.3Aquca_057_00157.4
Aquca_002_00330.4.155.497Aquca_002_00330.4.155.497Aquca_002_00330.2.100.442Aquca_002_00330.2.100.442Aquca_002_00330.1.155.497
Aquca_002_00330.1.155.497Aquca_002_00330.3.100.434Aquca_002_00330.3.100.434Aquca_002_00330.1.514.887Aquca_002_00330.1.514.887
Aquca_002_00330.3.451.826Aquca_002_00330.3.451.826Aquca_002_00330.2.459.834Aquca_002_00330.2.459.834Aquca_002_00330.4.514.785
Aquca_002_00330.4.514.785
Arabidopsis lyrata488189
Arabidopsis thalianaAT5G13690.1
Brachypodium distachyonBradi1g62007.1Bradi5g24207.1
Brassica rapaBra023429
Carica papayaevm.model.supercontig_125.32evm.model.supercontig_35.39evm.model.supercontig_35.44
Capsella rubellaCarubv10000251m
Citrus clementinaCiclev10030724mCiclev10018883mCiclev10019020mCiclev10019066mCiclev10019065m
Citrus sinensisorange1.1g003545morange1.1g006843morange1.1g006829morange1.1g008173morange1.1g009062m
orange1.1g009057morange1.1g009049morange1.1g012032morange1.1g012026morange1.1g009153m.237.531
orange1.1g009153m.237.531
Cucumis sativusCucsa.128090.1Cucsa.197210.1
Eucalyptus grandisEucgr.B00338.1Eucgr.G03358.1Eucgr.G03358.2Eucgr.B00338.2
Fragaria vescamrna09491.1-v1.0-hybrid.106.845
Glycine maxGlyma10g11720.3Glyma06g19791.1.94.437Glyma06g19791.1.94.437Glyma06g19791.1.438.763Glyma06g19791.1.438.763
Gossypium raimondiiGorai.004G170700.1Gorai.004G170700.3Gorai.004G170700.4Gorai.004G170700.2.346.780Gorai.004G170700.2.346.780
Gorai.001G078400.1.96.430Gorai.001G078400.1.96.430Gorai.004G170700.2.108.346Gorai.004G170700.2.108.346Gorai.001G078400.1.466.832
Gorai.001G078400.1.466.832
Linum usitatissimumLus10039598Lus10029494Lus10043468Lus10034116.106.408Lus10034116.106.408
Lus10034116.462.875Lus10034116.462.875
Malus domesticaMDP0000220242MDP0000138607MDP0000208532MDP0000203950MDP0000134637
Manihot esculentacassava4.1_001859mcassava4.1_003710mcassava4.1_022588mcassava4.1_012214m
Medicago truncatulaMedtr3g032980.2.357.804Medtr3g032980.2.357.804Medtr3g032980.1.357.829Medtr3g032980.1.357.829Medtr3g032980.3.95.333
Medtr3g032980.3.95.333Medtr3g032980.2.95.333Medtr3g032980.2.95.333Medtr3g032980.1.95.333Medtr3g032980.1.95.333
Medtr3g032980.3.357.529Medtr3g032980.3.357.529
Mimulus guttatusmgv1a001508mmgv1a018437m
Oryza sativaLOC_Os04g55730.1.99.440LOC_Os04g55730.1.99.440LOC_Os04g55730.1.441.772LOC_Os04g55730.1.441.772
Panicum virgatumPavirv00063217mPavirv00008468mPavirv00041670mPavirv00026596m.238.567Pavirv00026596m.238.567
Physcomitrella patensPp1s329_23V6.1
Phaseolus vulgarisPhvul.005G023300.1Phvul.005G023300.2Phvul.009G182100.1.92.435Phvul.009G182100.1.92.435Phvul.009G182100.2.253.577
Phvul.009G182100.2.253.577Phvul.009G182100.1.436.760Phvul.009G182100.1.436.760
Picea abiesMA_10437144g0010
Populus trichocarpaPotri.009G058100.1Potri.012G075900.1.100.435Potri.012G075900.1.100.435Potri.012G075900.1.436.751Potri.012G075900.1.436.751
Prunus persicappa001555mppa001642m
Ricinus communis30147.m01401129864.m001461
Setaria italicaSi034295mSi009392m.103.444Si009392m.103.444Si009392m.445.774Si009392m.445.774
Selaginella moellendorffii102402
Sorghum bicolorSb01g034960.1Sb06g030930.1
Thellungiella halophilaThhalv10012727m
Vitis viniferaGSVIVT01032165001GSVIVT01007826001.97.439GSVIVT01007826001.97.439GSVIVT01007826001.468.836GSVIVT01007826001.468.836
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)