y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna29636.1-v1.0-hybrid
FamilyGH33
Protein PropertiesLength: 325 Molecular Weight: 36329.1 Isoelectric Point: 4.6319
ChromosomeChromosome/Scaffold: 4 Start: 8785852 End: 8789105
DescriptionBNR/Asp-box repeat family protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH33253176.4e-28
  FAANSVPFNSCHASTIVEVDIDHFLVAYFGGSSEGAPDVKIWLQTYKNGYWQPPEVADEQPDVPMWNPVLFKLSSGELLLFYKIGQEVQKWSGCLKRSYD
  KGVTWTKREQLPPGILGPIKNKPILLENGDLLCGSSVESWNSWGAWVEVATDSVRSWRKYGPIYIENETLSVIQPVPYQTAKGTLRLLMRSFDHIGRVCI
  SESHDGGQNWEYAKPTDLPNPNSGIDGVKLRDGSVLLAYNTISRGVLKVALSDDDGDSWCDALTLEEDLEMEFSYPAVIQASDGCVHITYTYN
Full Sequence
Protein Sequence     Length: 325     Download
MSVPPIINLR KDRFLEGPVL QEYTFAANSV PFNSCHASTI VEVDIDHFLV AYFGGSSEGA    60
PDVKIWLQTY KNGYWQPPEV ADEQPDVPMW NPVLFKLSSG ELLLFYKIGQ EVQKWSGCLK    120
RSYDKGVTWT KREQLPPGIL GPIKNKPILL ENGDLLCGSS VESWNSWGAW VEVATDSVRS    180
WRKYGPIYIE NETLSVIQPV PYQTAKGTLR LLMRSFDHIG RVCISESHDG GQNWEYAKPT    240
DLPNPNSGID GVKLRDGSVL LAYNTISRGV LKVALSDDDG DSWCDALTLE EDLEMEFSYP    300
AVIQASDGCV HITYTYNRTQ VKDI*                                          360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00260Sialidase0.00275283249+
COG4692COG46927.0e-2631324349+
pfam13088BNR_27.0e-9346312282+
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_027_00263.5Aquca_027_00263.1Aquca_027_00263.2Aquca_027_00263.3Aquca_027_00263.4
Arabidopsis lyrata495867
Arabidopsis thalianaAT5G57700.1AT5G57700.2AT5G57700.3AT5G57700.4
Brachypodium distachyonBradi1g26287.2Bradi1g26287.4Bradi1g26287.1Bradi1g26287.3
Brassica rapaBra006806
Capsella rubellaCarubv10028058m
Citrus clementinaCiclev10008429m
Citrus sinensisorange1.1g020796m
Cucumis sativusCucsa.063760.7Cucsa.063760.5Cucsa.063760.1
Eucalyptus grandisEucgr.C02440.3Eucgr.C02440.2Eucgr.C02440.1
Glycine maxGlyma13g01390.2Glyma13g01380.1Glyma17g07500.2Glyma17g07500.3Glyma17g07500.1
Gossypium raimondiiGorai.010G053100.8Gorai.010G053100.9Gorai.010G053100.6Gorai.012G095700.1Gorai.010G053100.5
Gorai.010G053100.4Gorai.010G053100.3Gorai.010G053100.2Gorai.010G053100.10Gorai.010G053100.1
Linum usitatissimumLus10008903
Malus domesticaMDP0000155009
Manihot esculentacassava4.1_011952m
Medicago truncatulaMedtr4g129200.1Medtr4g129180.1
Mimulus guttatusmgv1a018339m
Oryza sativaLOC_Os07g33220.1LOC_Os07g33224.1
Panicum virgatumPavirv00000088mPavirv00019697mPavirv00063023mPavirv00001202mPavirv00001203m
Pavirv00068158mPavirv00059537m
Physcomitrella patensPp1s96_140V6.2
Phaseolus vulgarisPhvul.003G150200.1Phvul.003G150000.2Phvul.003G150000.1Phvul.003G150000.4Phvul.003G150000.5
Phvul.003G150000.3Phvul.003G150000.6
Picea abiesMA_10435121g0010
Populus trichocarpaPotri.018G097100.1
Prunus persicappa020159m
Ricinus communis29749.m000140
Setaria italicaSi030500mSi030939mSi030026mSi029094m
Selaginella moellendorffii84263
Sorghum bicolorSb02g034675.1Sb02g034680.1
Thellungiella halophilaThhalv10013983m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny