y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna29734.1-v1.0-hybrid
FamilyCBM57
Protein PropertiesLength: 682 Molecular Weight: 74929.5 Isoelectric Point: 7.0308
ChromosomeChromosome/Scaffold: 3 Start: 4458976 End: 4463465
Descriptionreceptor like protein 4
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM572643745.2e-23
  PNFYPAGLYERAIVSSDSKPDIEYTMDVDPNRNYSIWLHFAEIDESINGVGQRVFDIIINGDIAFEEVDIVKFSGDRNSALVLNTTVPVNGRSLTITLKP
  KNRDHAIICAI
Full Sequence
Protein Sequence     Length: 682     Download
MKIANVYKIS VYYLIFCFIF LFLIGWCFAF NLSDGVSSTA PYAMRINCGA RHDVHTAPTN    60
TLWYRDFGYT GGIPANASLP SYVSPHLDTL RYFPLSEGPE NCYIINRVPK GHYSVRVFFG    120
SVQLKSDDLE PLFDISVEGT LITSLKSGWS NVDDQVFAEA QVFLTDGSVS ICFHSTGHGD    180
PAILALEILQ IDDKAYQFSQ HSGQGIILRT VLRLSCGDGR PKFGADYGGD PWGGDRFWKP    240
ITTFGGGDKS ISIEASIKQV SKPPNFYPAG LYERAIVSSD SKPDIEYTMD VDPNRNYSIW    300
LHFAEIDESI NGVGQRVFDI IINGDIAFEE VDIVKFSGDR NSALVLNTTV PVNGRSLTIT    360
LKPKNRDHAI ICAIEIFEII VAESKTLPDE VKALQTLKTT LGLPVRLGWN GDPCVPQQHP    420
WSGADCQFDK STSKWVIDGL GLDNQGLKGF LQNDISKLRH LQSINLSGNN IHGAIPSSLG    480
AIPSLEVLDL SYNSFNGSIP ETLGQLTSLQ RLYLNSNSLS GRVPAALGGR LLHRASFNFT    540
DNHGLCGIPG LRTCGPHLTA GAKIGLAFGV LGSAVGKGGR IYCEHSKWLQ EKLHMQRRGP    600
IYPRTFSCPG TIIIMANREQ QLKMDRFCFH DPTNLQLTLI PNLVKVCYCL GARTAVDPRH    660
ESLAIRVDGL ACLHQYSFSQ P*                                             720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN00113PLN001135.0e-12440554118+
PLN00113PLN001133.0e-14440551112+
PLN00113PLN001132.0e-1444052990+
pfam12819Malectin_like1.0e-6146366335+
PLN03150PLN03150026571551+
Gene Ontology
GO TermDescription
GO:0005515protein binding
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3rgz_A0.000000000006412556611750A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens
PDB3rgz_A0.000000008436527467558A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens
PDB3rgz_A0.00000005426527389486A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens
PDB3rgz_A0.000002447528454535A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens
PDB3rgz_A0.0007461528370439A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens
Transmembrane Domains
StartEnd
729
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01105.1Aquca_026_00194.1Aquca_036_00074.1
Arabidopsis thalianaAT1G28340.1
Brachypodium distachyonBradi1g26830.1
Brassica rapaBra032897
Carica papayaevm.model.supercontig_27.21
Capsella rubellaCarubv10008578m
Citrus clementinaCiclev10014874mCiclev10014609m
Citrus sinensisorange1.1g013887morange1.1g012913morange1.1g010819morange1.1g009515morange1.1g007860m
orange1.1g007307morange1.1g006793morange1.1g015373morange1.1g009603morange1.1g009236m
orange1.1g006940morange1.1g006035m
Cucumis sativusCucsa.147330.1Cucsa.126850.1
Eucalyptus grandisEucgr.G02346.3Eucgr.E03253.2Eucgr.E03253.1Eucgr.D00605.1
Fragaria vescamrna03872.1-v1.0-hybrid
Glycine maxGlyma02g11090.2Glyma02g11090.1Glyma01g22406.1Glyma20g32720.1Glyma15g08350.4
Glyma15g08350.3Glyma13g31020.4Glyma13g31020.3Glyma13g24550.1Glyma07g31970.1
Glyma07g31970.2
Gossypium raimondiiGorai.005G138000.3Gorai.005G138000.2Gorai.005G138000.1Gorai.011G029600.2Gorai.011G029600.1
Gorai.006G087900.8Gorai.006G087900.7Gorai.006G087900.6Gorai.006G087900.5Gorai.006G087900.4
Gorai.006G087900.3Gorai.006G087900.2Gorai.006G087900.1
Linum usitatissimumLus10041488Lus10034275Lus10015417Lus10013994Lus10015320
Malus domesticaMDP0000298053MDP0000124675
Manihot esculentacassava4.1_031190mcassava4.1_008047mcassava4.1_003726mcassava4.1_003546mcassava4.1_034042m
Medicago truncatulaMedtr5g053610.1Medtr2g014290.1
Mimulus guttatusmgv1a002935m
Oryza sativaLOC_Os07g31840.1
Panicum virgatumPavirv00022924mPavirv00022923mPavirv00008373m
Physcomitrella patensPp1s83_48V6.1Pp1s199_124V6.1Pp1s5_311V6.1Pp1s1_97V6.1Pp1s2_327V6.1
Pp1s6_364V6.1
Phaseolus vulgarisPhvul.007G102400.1Phvul.003G027500.1Phvul.006G183300.2Phvul.006G183300.1Phvul.002G230800.1
Phvul.003G239400.1
Picea abiesMA_199958g0010MA_41304g0010
Populus trichocarpaPotri.010G129300.3Potri.010G129300.2Potri.010G129300.1Potri.008G117000.2Potri.008G117000.1
Potri.011G056800.2Potri.011G056800.1Potri.004G047300.4Potri.004G047300.3Potri.004G047300.2
Potri.004G047300.1
Prunus persicappa002857mppa003081m
Ricinus communis29738.m00104930190.m011324
Setaria italicaSi029205m
Selaginella moellendorffii133089
Sorghum bicolorSb02g034070.1
Thellungiella halophilaThhalv10007074m
Vitis viniferaGSVIVT01021096001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)