y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna29749.1-v1.0-hybrid
FamilyGT35
Protein PropertiesLength: 1010 Molecular Weight: 113403 Isoelectric Point: 5.9646
ChromosomeChromosome/Scaffold: 3 Start: 4545769 End: 4552981
Descriptionalpha-glucan phosphorylase 2
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT352889990
  ALSQLGFEFEVLAEQEGDAALGNGGLARLSACQMDSMATLDYPAWGYGLRYQYGLFRQVILDGFQHEQPDFWLNFGNPWETERVHVTYPVKFYGTVDEEI
  VNGEKCNVWNPGEVVEAVAYDNPIPGYGTRNTITLRLWAGKPSDQRDMEAFNTGDYINAVVSRQKAENISSVLYPDDRSYQGKELRLKQQYFFVSASIQD
  IIRRFKDAHSNFDEFPDKVALQLNDTHPSLAIVEVMRVLVDEEHLDWKRAWDIVCKLFSFTIHAVIAEGLEKIPVDLLGSLLPRHLQIIYDINFNFVEEL
  KKRIGLDYDRLSRMSIVEEAAVKSIRMANLAVVCAHTVNGVSQVHSELLRTKLFKDFYELWPEKFQCKTNGVTQRRWIVVSNPSLCALLSKWLGTESWIR
  NVDLLAGLREYADDADLQQEWMMVKKVNKMRLAEYIEAMSGVKVSLDAMFDVQTKRIHEYKRQLLNILGIIHRYDCIKNMDKSQQSKVVPRVCIIGGKAA
  PGYEVAKKIIKLCHAVADKINNDSDVGDLLKLIFIPDYNVSLAEVVIPGADLSQHLSTAGHEASGTGSMKFLMNGCLLLATEDGSTVEIVEEIGDENLFL
  FGTKIHEVPELRERGPAHDMPLQCARVLRLIRDGHFGFQDYFQSLCDSVEGDDFYLLSSDFGSYLEAQAAADKAFVDPKKWAKMSILSTAGSGRFSSDTT
  IRDYAEKSWGIE
Full Sequence
Protein Sequence     Length: 1010     Download
MSILPSRFLT IPHHPSLAFS HYSPPPLLQT VPRSSLFHAP SNVPRPLRAS ATSPSSSSSS    60
VTVENSSDSE SDAASGGAPA TLFVIRARNR IGLLGIITRV FNVLGLRVEK ATVEFEGDFF    120
VKRFFVTDSR GARIEDRDSL DRIQKALLDA IDDCAGTVSA GPTTTRGVVV RRPGLGLGSG    180
DRAAKAERMF GLMDGFLKND PISLQKDILY HVEYTVARSR FSFDDFEAYQ ALAHSVRDRL    240
IERSHDTQLY FKRKDPKRVY FLSLEFLMGR SLSNSVINLG IRDQYAEALS QLGFEFEVLA    300
EQEGDAALGN GGLARLSACQ MDSMATLDYP AWGYGLRYQY GLFRQVILDG FQHEQPDFWL    360
NFGNPWETER VHVTYPVKFY GTVDEEIVNG EKCNVWNPGE VVEAVAYDNP IPGYGTRNTI    420
TLRLWAGKPS DQRDMEAFNT GDYINAVVSR QKAENISSVL YPDDRSYQGK ELRLKQQYFF    480
VSASIQDIIR RFKDAHSNFD EFPDKVALQL NDTHPSLAIV EVMRVLVDEE HLDWKRAWDI    540
VCKLFSFTIH AVIAEGLEKI PVDLLGSLLP RHLQIIYDIN FNFVEELKKR IGLDYDRLSR    600
MSIVEEAAVK SIRMANLAVV CAHTVNGVSQ VHSELLRTKL FKDFYELWPE KFQCKTNGVT    660
QRRWIVVSNP SLCALLSKWL GTESWIRNVD LLAGLREYAD DADLQQEWMM VKKVNKMRLA    720
EYIEAMSGVK VSLDAMFDVQ TKRIHEYKRQ LLNILGIIHR YDCIKNMDKS QQSKVVPRVC    780
IIGGKAAPGY EVAKKIIKLC HAVADKINND SDVGDLLKLI FIPDYNVSLA EVVIPGADLS    840
QHLSTAGHEA SGTGSMKFLM NGCLLLATED GSTVEIVEEI GDENLFLFGT KIHEVPELRE    900
RGPAHDMPLQ CARVLRLIRD GHFGFQDYFQ SLCDSVEGDD FYLLSSDFGS YLEAQAAADK    960
AFVDPKKWAK MSILSTAGSG RFSSDTTIRD YAEKSWGIEP CRFPSESDG*               1020
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd04300GT1_Glycogen_Phosphorylase0205998801+
TIGR02093P_ylase0208998800+
pfam00343Phosphorylase02881000719+
PRK14986PRK1498602031002810+
COG0058GlgP02031000812+
Gene Ontology
GO TermDescription
GO:0004645phosphorylase activity
GO:0005975carbohydrate metabolic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ygp_B0199100139878A Chain A, Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site.
PDB1ygp_A0199100139878A Chain A, Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site.
PDB1c50_A0204100215819A Chain A, Identification And Structural Characterization Of A Novel Allosteric Binding Site Of Glycogen Phosphorylase B
PDB1abb_D0204100218822A Chain A, Control Of Phosphorylase B Conformation By A Modified Cofactor: Crystallographic Studies On R-State Glycogen Phosphorylase Reconstituted With Pyridoxal 5'-Diphosphate
PDB1abb_C0204100218822A Chain A, Control Of Phosphorylase B Conformation By A Modified Cofactor: Crystallographic Studies On R-State Glycogen Phosphorylase Reconstituted With Pyridoxal 5'-Diphosphate
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00755.3Aquca_009_00755.2Aquca_009_00755.1Aquca_002_00786.1Aquca_002_00786.2
Arabidopsis lyrata485074323006
Arabidopsis thalianaAT3G46970.1AT3G29320.1
Brachypodium distachyonBradi2g55120.1Bradi1g08070.1.569.972Bradi1g08070.1.569.972Bradi1g08070.1.163.525Bradi1g08070.1.163.525
Brassica rapaBra018180Bra025392Bra033098
Carica papayaevm.model.supercontig_27.5evm.model.supercontig_112.64.358.739evm.model.supercontig_112.64.358.739evm.model.supercontig_14.158evm.model.supercontig_112.64.117.357
evm.model.supercontig_112.64.117.357
Capsella rubellaCarubv10019408mCarubv10016634m
Chlamydomonas reinhardtiiCre12.g552200.t1.2Cre07.g336950.t1.1
Citrus clementinaCiclev10027815mCiclev10027813mCiclev10010975m.585.995Ciclev10010975m.585.995Ciclev10010975m.176.514
Ciclev10010975m.176.514
Citrus sinensisorange1.1g004485morange1.1g003202morange1.1g003197morange1.1g003196morange1.1g003188m
orange1.1g003186morange1.1g005595morange1.1g003693morange1.1g003742morange1.1g004697m
orange1.1g004696morange1.1g007597morange1.1g003875m.374.784orange1.1g003875m.374.784orange1.1g003079m.434.844
orange1.1g003079m.434.844orange1.1g003074m.434.844orange1.1g003074m.434.844orange1.1g003072m.434.844orange1.1g003072m.434.844
orange1.1g003055m.436.846orange1.1g003055m.436.846orange1.1g001879m.585.995orange1.1g001879m.585.995orange1.1g009651m
orange1.1g002111morange1.1g012447morange1.1g005402m.400.692orange1.1g005402m.400.692orange1.1g005402m.25.349
orange1.1g005402m.25.349orange1.1g003079m.25.349orange1.1g003079m.25.349orange1.1g003074m.25.349orange1.1g003074m.25.349
orange1.1g003072m.25.349orange1.1g003072m.25.349orange1.1g001879m.176.500orange1.1g001879m.176.500orange1.1g003055m.25.351
orange1.1g003055m.25.351orange1.1g026345m
Cucumis sativusCucsa.126920.10Cucsa.126920.1Cucsa.139040.4Cucsa.139040.3Cucsa.139040.2
Cucsa.139040.1Cucsa.284600.1Cucsa.273090.1
Eucalyptus grandisEucgr.B02278.2Eucgr.B02278.1Eucgr.B03166.3Eucgr.B03166.2Eucgr.J01374.1
Eucgr.B03166.1Eucgr.B03166.5Eucgr.B03166.4
Fragaria vescamrna07968.1-v1.0-hybridmrna04322.1-v1.0-hybrid.157.481mrna04322.1-v1.0-hybrid.157.481
Glycine maxGlyma13g30920.2Glyma13g30920.3Glyma08g45210.1Glyma18g07480.1Glyma20g03250.4.554.965
Glyma20g03250.4.554.965Glyma20g03250.3.562.973Glyma20g03250.3.562.973Glyma20g03250.2.562.973Glyma20g03250.2.562.973
Glyma13g06040.1Glyma19g03490.1Glyma20g03250.4.161.485Glyma20g03250.4.161.485Glyma20g03250.3.169.493
Glyma20g03250.3.169.493Glyma20g03250.2.169.493Glyma20g03250.2.169.493
Gossypium raimondiiGorai.009G166800.1Gorai.013G260900.2Gorai.013G260900.1Gorai.013G260900.3Gorai.006G011500.7.330.728
Gorai.006G011500.7.330.728Gorai.006G011500.4.514.912Gorai.006G011500.4.514.912Gorai.006G011500.3.580.978Gorai.006G011500.3.580.978
Gorai.006G011500.2.583.981Gorai.006G011500.2.583.981Gorai.006G011500.1.583.986Gorai.006G011500.1.583.986Gorai.013G092200.1
Gorai.013G092200.2Gorai.006G011500.6.177.501Gorai.006G011500.6.177.501Gorai.006G011500.5.180.504Gorai.006G011500.5.180.504
Gorai.006G011500.4.111.435Gorai.006G011500.4.111.435Gorai.006G011500.3.177.501Gorai.006G011500.3.177.501Gorai.006G011500.2.180.504
Gorai.006G011500.2.180.504Gorai.006G011500.1.180.504Gorai.006G011500.1.180.504Gorai.006G011500.6.580.815Gorai.006G011500.6.580.815
Gorai.006G011500.5.583.818Gorai.006G011500.5.583.818
Linum usitatissimumLus10036892Lus10042688Lus10037093Lus10029643Lus10029644
Malus domesticaMDP0000288190MDP0000123354MDP0000266061MDP0000129346.602.999MDP0000129346.602.999
MDP0000145828MDP0000128518MDP0000778598MDP0000259799MDP0000129346.170.509
MDP0000129346.170.509MDP0000211642
Manihot esculentacassava4.1_001626mcassava4.1_002082mcassava4.1_024481mcassava4.1_002466mcassava4.1_002614m.310.707
cassava4.1_002614m.310.707cassava4.1_001096mcassava4.1_025456mcassava4.1_007176mcassava4.1_004717m.211.560
cassava4.1_004717m.211.560cassava4.1_002614m.25.217cassava4.1_002614m.25.217cassava4.1_004717m.25.195cassava4.1_004717m.25.195
cassava4.1_009211m
Medicago truncatulaMedtr2g014460.1Medtr6g014480.1Medtr4g082950.1.578.876Medtr4g082950.1.578.876Medtr4g082950.1.170.494
Medtr4g082950.1.170.494Medtr6g014480.2
Mimulus guttatusmgv1a000698mmgv1a001277mmgv1a000878mmgv1a002586mmgv1a002585m
Oryza sativaLOC_Os01g63270.1LOC_Os01g63270.2LOC_Os03g55090.1
Panicum virgatumPavirv00009874mPavirv00050649mPavirv00050650mPavirv00004990m.515.914Pavirv00004990m.515.914
Pavirv00034922m.529.918Pavirv00034922m.529.918Pavirv00034922m.119.465Pavirv00034922m.119.465Pavirv00004990m.97.438
Pavirv00004990m.97.438
Physcomitrella patensPp1s30_182V6.1Pp1s180_124V6.1Pp1s86_213V6.1Pp1s195_41V6.1Pp1s53_212V6.1.566.981
Pp1s53_212V6.1.566.981Pp1s53_212V6.1.179.499Pp1s53_212V6.1.179.499
Phaseolus vulgarisPhvul.006G182300.1Phvul.006G064100.1Phvul.002G168400.1.570.971Phvul.002G168400.1.570.971Phvul.004G034400.1.582.980
Phvul.004G034400.1.582.980Phvul.002G168400.1.169.519Phvul.002G168400.1.169.519Phvul.004G034400.1.180.504Phvul.004G034400.1.180.504
Picea abiesMA_10437129g0010MA_14581g0010MA_10428980g0010
Populus trichocarpaPotri.004G048600.1Potri.004G048600.2Potri.009G041800.1Potri.009G041800.3Potri.010G160200.2
Potri.009G041800.4Potri.009G041800.2.126.655Potri.009G041800.2.126.655Potri.004G123600.5Potri.010G160200.5
Potri.010G160200.1Potri.010G160200.7Potri.010G160200.4Potri.010G160200.3Potri.004G123600.4.176.534
Potri.004G123600.4.176.534Potri.004G123600.3.176.534Potri.004G123600.3.176.534Potri.004G123600.2.176.534Potri.004G123600.2.176.534
Potri.004G123600.1.176.533Potri.004G123600.1.176.533Potri.010G160200.6Potri.009G041800.2.660.825Potri.009G041800.2.660.825
Prunus persicappa000587mppa001354mppa000958mppa000827m.586.983ppa000827m.586.983
ppa000827m.171.506ppa000827m.171.506
Ricinus communis29751.m00179630190.m011310.461.94330190.m011310.461.94330174.m00913629630.m000793
30190.m011310.264.44430190.m011310.264.444
Setaria italicaSi000306mSi034019m
Selaginella moellendorffii148158164611184206
Sorghum bicolorSb03g040060.1Sb01g007560.2.550.949Sb01g007560.2.550.949Sb01g007560.1.580.979Sb01g007560.1.580.979
Sb01g007560.2.140.492Sb01g007560.2.140.492Sb01g007560.1.170.522Sb01g007560.1.170.522
Thellungiella halophilaThhalv10010122mThhalv10003599m
Vitis viniferaGSVIVT01021111001GSVIVT01024804001GSVIVT01012194001GSVIVT01011504001.577.977GSVIVT01011504001.577.977
GSVIVT01011504001.177.501GSVIVT01011504001.177.501
Volvox carteriVocar20006426mVocar20001423m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)