y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna29784.1-v1.0-hybrid
FamilyGT1
Protein PropertiesLength: 452 Molecular Weight: 50775.9 Isoelectric Point: 6.7337
ChromosomeChromosome/Scaffold: 3 Start: 4725812 End: 4727167
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12264122.6e-22
  MNKPVILAGPVMPDPPSSQLEEKWARWLGGFEPRTVIFCALGSEYILTKQQLQQLLLGFELTGFPFFAALKPPTGVESIESALPEGFEERVKGKGVVYGS
  WVQQPLILKHPSVGCFVTHCGSGSLNEALLNECQLVFLPNILDQIINARMMSGELKVGVEVEKGDEDGLFTKEGVCKAVKAVMDENS
Full Sequence
Protein Sequence     Length: 452     Download
MSDQTLHIAM YPWFAMGHLT AFLHISNKLA ERGNKISFFL PLKTRSKLQH YNLHPRLITF    60
IPLSVPHVDG LPLGTETTAD IDLSLGSLLA TAMDLTRPQI EQSLIELKPD FVFFDLSYWL    120
PAMLRGLATN IKSIYYSVIN PATIWFGLRN LVLPRKNQLD EAYRSFSIKL QTHEVRAYDA    180
MMNMKYGSEV TFSKRLMTSR SDCDAICFQS CRELAEPFSN YIEIRMNKPV ILAGPVMPDP    240
PSSQLEEKWA RWLGGFEPRT VIFCALGSEY ILTKQQLQQL LLGFELTGFP FFAALKPPTG    300
VESIESALPE GFEERVKGKG VVYGSWVQQP LILKHPSVGC FVTHCGSGSL NEALLNECQL    360
VFLPNILDQI INARMMSGEL KVGVEVEKGD EDGLFTKEGV CKAVKAVMDE NSEVGKEVKI    420
NHAKWREFLS SKGLESSYID DFVQKLHKLL G*                                  480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02863PLN028633.0e-297449479+
PLN02670PLN026701.0e-656412438+
PLN00414PLN004143.0e-1376446447+
PLN02208PLN022084.0e-1423450457+
PLN02764PLN027641.0e-1461450457+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vg8_A9e-2344275444A Chain A, Trehalose-6-Phosphate From E. Coli Bound With Udp-Glucose.
PDB2vch_A9e-2344275444A Chain A, Trehalose-6-Phosphate From E. Coli Bound With Udp-Glucose.
PDB2vce_A9e-2344275444A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2c9z_A1e-19174443181444A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2c1z_A1e-19174443181444A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_055_00117.1Aquca_038_00188.1Aquca_055_00115.1Aquca_023_00112.1Aquca_011_00587.1
Aquca_011_00580.1
Arabidopsis lyrata474186918511492036495482918509
475492
Arabidopsis thalianaAT3G29630.1AT5G53990.1AT5G54010.1AT5G54060.1AT1G64910.1
Brassica rapaBra029046Bra022688Bra029045
Carica papayaevm.model.supercontig_8.121
Capsella rubellaCarubv10027945m
Citrus clementinaCiclev10017784mCiclev10008184mCiclev10015186m
Citrus sinensisorange1.1g039043morange1.1g017557morange1.1g012080m
Cucumis sativusCucsa.032470.1Cucsa.148900.1Cucsa.148870.1Cucsa.148880.1Cucsa.180970.1
Eucalyptus grandisEucgr.F03293.1Eucgr.F03295.1Eucgr.K01076.1Eucgr.K01079.1Eucgr.F03297.1
Fragaria vescamrna16456.1-v1.0-hybridmrna27158.1-v1.0-hybridmrna20937.1-v1.0-hybridmrna13733.1-v1.0-hybridmrna16457.1-v1.0-hybrid
Glycine maxGlyma10g33790.1Glyma20g33810.1Glyma12g34045.1Glyma06g43880.1Glyma12g14050.1
Glyma13g36500.1Glyma13g36490.1Glyma06g35110.1Glyma12g34030.1Glyma08g44550.1
Glyma13g32770.1
Gossypium raimondiiGorai.007G157200.1Gorai.002G066600.1Gorai.002G065400.1Gorai.002G065400.2Gorai.002G065300.1
Gorai.010G242800.1Gorai.002G065500.1Gorai.010G230400.1Gorai.010G230200.1Gorai.009G439200.1
Linum usitatissimumLus10008453Lus10013337Lus10040178
Malus domesticaMDP0000311492MDP0000729320MDP0000319451MDP0000729321
Manihot esculentacassava4.1_028194mcassava4.1_024244mcassava4.1_026854mcassava4.1_021802mcassava4.1_007290m
Medicago truncatulaMedtr4g079270.1Medtr4g079250.1Medtr2g014900.1Medtr2g083390.1Medtr2g083420.1
Mimulus guttatusmgv1a019428mmgv1a006277mmgv1a006102mmgv1a006231mmgv1a021196m
Panicum virgatumPavirv00057507m
Phaseolus vulgarisPhvul.007G135800.1Phvul.011G136400.1Phvul.011G115700.1Phvul.005G093600.1Phvul.011G128700.1
Phvul.011G138500.1Phvul.011G138600.1Phvul.005G093300.1Phvul.005G093500.2Phvul.005G093500.1
Populus trichocarpaPotri.011G061000.1Potri.011G060300.1Potri.006G179700.1Potri.011G097900.1
Prunus persicappa022356mppa024453m
Ricinus communis29900.m00155029705.m000575
Sorghum bicolorSb08g003060.1
Thellungiella halophilaThhalv10013536mThhalv10013535mThhalv10028656mThhalv10013471m
Vitis viniferaGSVIVT01014265001GSVIVT01014272001GSVIVT01014269001GSVIVT01014271001GSVIVT01014270001
GSVIVT01014267001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)