y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna29905.1-v1.0-hybrid
FamilyGH116
Protein PropertiesLength: 917 Molecular Weight: 102366 Isoelectric Point: 7.0811
ChromosomeChromosome/Scaffold: 4 Start: 1636435 End: 1644463
DescriptionBeta-glucosidase, GBA2 type family protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1164988600
  GRFLYLEGVEYIMWNTYDVHFYASFALLDLFPKIELNIQRDFAKAVLSEDGRRVKFLAEGNWGIRKVRGAVPHDLGTHDPWNEMNAYNIHDTSKWKDLNP
  KFVLQVYRDFAATGDMSFGVDVWPAVRAAMEYMEQFDRDNDGLIENDGFPDQTYDAWTVHGVSAYCGCLWLAALQAAAAMAIQLGDKAFAEWCKTKFLKA
  KPAFEEKLWNGSYFNYDSGSSSNSKSIQADQLAGQWYTASSGLPSLFDDAKVQSALQKIYDFNVMKVKGGRMGAVNGMHPNGRVDESCMQSREIWTGVTY
  GVAATMILAGKEKEAFTTAEGIFIAGWSEEGYGYGFQTPEGWTMDGHFRSLIYMRPLSIWSMQ
Full Sequence
Protein Sequence     Length: 917     Download
MVSGNLFHCR KNSWPPQEYI PRNTLQLFDT DSAAPPEQAW RRKLNSHANI LKEFSITFRE    60
AIKMVRLGVR LWSYVREEAS HGRKAPIDPF TRGICKPSAS QGVPLGGMGS GSISRGFRGE    120
FRQWQIIPGV CDGSPVMANQ FSIFISRDGG SKSYASVLAP GQHDGIGKAG DQGISSWGWN    180
LGGQHSTYHA LFPRAWTVYD GEPDPELKIS CRQISPFIPH NYRDSSLPTA VFVYTLVNTG    240
KERAKVSLLF TWANSIGGIS HLSGDHVNEP FMTAKGSPPV TFAIAACETQ NVSVSVLPCF    300
GLSEESSVTA KEMWDQMVKD GQFDRENFNS GPCMSSSPGE TLCAAVSATA WVEPHGKCTV    360
AFGLSWSSPK VKFLKGSSYP RRYTKFYGTS ERAAQDLVHD ALTNYKRWEE EIEIWQNPIL    420
KDEKLPEWYK FTLFNELYFL VAGGTVWIDS PSLDKKIKKN QSQLTNGEYN KATEHKVNGK    480
VVEDTAMLDP QKHYEDVGRF LYLEGVEYIM WNTYDVHFYA SFALLDLFPK IELNIQRDFA    540
KAVLSEDGRR VKFLAEGNWG IRKVRGAVPH DLGTHDPWNE MNAYNIHDTS KWKDLNPKFV    600
LQVYRDFAAT GDMSFGVDVW PAVRAAMEYM EQFDRDNDGL IENDGFPDQT YDAWTVHGVS    660
AYCGCLWLAA LQAAAAMAIQ LGDKAFAEWC KTKFLKAKPA FEEKLWNGSY FNYDSGSSSN    720
SKSIQADQLA GQWYTASSGL PSLFDDAKVQ SALQKIYDFN VMKVKGGRMG AVNGMHPNGR    780
VDESCMQSRE IWTGVTYGVA ATMILAGKEK EAFTTAEGIF IAGWSEEGYG YGFQTPEGWT    840
MDGHFRSLIY MRPLSIWSMQ WALSMPKAIL EAPKANVMDR IHISSLSSRS SHSETGVRKI    900
ATKAKCFSNS VFNCAC*                                                   960
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3408GDB10.008565655100+
pfam12215GBA2_N6.0e-62102408332+
COG4354COG43541.0e-96102863790+
pfam04685DUF6083.0e-147498861367+
Gene Ontology
GO TermDescription
GO:0004348glucosylceramidase activity
GO:0006665sphingolipid metabolic process
GO:0016021integral to membrane
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00087.2Aquca_017_00087.1Aquca_034_00116.1
Arabidopsis lyrata331392479911473529327181
Arabidopsis thalianaAT1G33700.2AT1G33700.1AT5G49900.1AT3G24180.2AT3G24180.1
AT4G10060.1
Brachypodium distachyonBradi3g28580.1Bradi4g21277.1Bradi3g13487.1Bradi1g28847.1Bradi3g13520.1
Brassica rapaBra014964Bra028008Bra000598Bra028320Bra033199
Carica papayaevm.model.supercontig_59.121evm.model.supercontig_21.79evm.model.supercontig_113.12
Capsella rubellaCarubv10025826mCarubv10012912mCarubv10008221mCarubv10002637m
Citrus clementinaCiclev10004255mCiclev10000199mCiclev10018743mCiclev10018742m
Citrus sinensisorange1.1g039165morange1.1g002202morange1.1g038924m
Cucumis sativusCucsa.266300.2Cucsa.266300.1Cucsa.023010.1Cucsa.237200.1Cucsa.237200.2
Eucalyptus grandisEucgr.I02786.1Eucgr.H02851.2Eucgr.H02851.1Eucgr.H00075.1Eucgr.F02980.1
Eucgr.F02980.2
Fragaria vescamrna02278.1-v1.0-hybrid
Glycine maxGlyma10g33610.1Glyma20g33990.1Glyma07g40310.2
Gossypium raimondiiGorai.008G046700.1Gorai.011G160300.5Gorai.011G160300.4Gorai.011G160300.3Gorai.011G160300.2
Gorai.011G160300.1Gorai.013G133800.2Gorai.013G133800.1Gorai.006G221200.3Gorai.006G221200.2
Gorai.006G221200.1Gorai.008G046700.3Gorai.008G046700.2.531.722Gorai.008G046700.2.531.722Gorai.008G046700.2.724.851
Gorai.008G046700.2.724.851
Linum usitatissimumLus10000757Lus10003517Lus10002950Lus10023340Lus10038471
Lus10038469
Malus domesticaMDP0000175141MDP0000220028MDP0000128604
Manihot esculentacassava4.1_001108mcassava4.1_002224mcassava4.1_003299mcassava4.1_005809m
Medicago truncatulaMedtr1g072720.1Medtr1g072680.1
Mimulus guttatusmgv1a000876mmgv1a000873m
Oryza sativaLOC_Os10g33420.1LOC_Os11g13810.1LOC_Os08g01940.2LOC_Os08g01940.1LOC_Os07g26210.1
LOC_Os07g26210.2
Panicum virgatumPavirv00047844mPavirv00042892mPavirv00041095mPavirv00002207mPavirv00050055m
Pavirv00014420mPavirv00035631mPavirv00038108m
Physcomitrella patensPp1s134_55V6.1Pp1s40_202V6.1
Phaseolus vulgarisPhvul.007G134300.1Phvul.003G075400.1
Picea abiesMA_10430605g0020MA_10431145g0020MA_61180g0010MA_35878g0010MA_10426003g0020.110.198
MA_10426003g0020.110.198MA_165077g0010
Populus trichocarpaPotri.T163400.1Potri.019G072800.2Potri.019G072800.1Potri.004G227200.4Potri.004G227200.2
Potri.004G227200.1Potri.003G178000.4Potri.003G178000.3Potri.003G178000.2Potri.003G178000.1
Potri.003G003400.1Potri.003G003400.2Potri.019G072800.3Potri.004G227200.3Potri.003G003400.3
Prunus persicappa001012mppa000954m
Ricinus communis29685.m00048429757.m00075229904.m002967
Setaria italicaSi034088mSi026057mSi025923mSi029270mSi028945m
Si028854mSi013210mSi026013m
Selaginella moellendorffii16663492385
Sorghum bicolorSb01g019510.2Sb01g019510.1Sb05g007160.1Sb0073s002050.1Sb07g001140.1
Thellungiella halophilaThhalv10006714mThhalv10012588mThhalv10020003mThhalv10020001m
Vitis viniferaGSVIVT01036381001GSVIVT01023217001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)