y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna29953.1-v1.0-hybrid
FamilyAA2
Protein PropertiesLength: 483 Molecular Weight: 53123.3 Isoelectric Point: 7.7753
ChromosomeChromosome/Scaffold: 3 Start: 24880894 End: 24884926
DescriptionPeroxidase superfamily protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA21734620
  YGQHRDVSAQLLRLFFHDCFIEGCDASVLLDDSNGNQNHAIEKQAIPNRSLKGFDKIDEIKERLENECPGVVSCADVLALATRDAIVLAGGPFYPILTGR
  RDSTSSFFNEAMTGIPRPDDNINQTLHQFSLRGFDERETVALLGGHNIGKIGCEFIMSRINNFKGTGQPDPTIPPEFVTEMRLNCDDDSNQATSNAAAAA
  SPFVSRGLREKFTSQGMSYYQQLSSSFSTGAGFDSHYYQSLLRGRGLLFADQQLMANKRTARVVTAYASDGGSAFRMDFARAMMKMSVLN
Full Sequence
Protein Sequence     Length: 483     Download
MKSRRDGEVI RMVRRRALLV KEKLQMAAAK QNAFHFPLQH SHSLSVTLPL LTNPNDAVSD    60
LTTSPATLKS KKPTKMLFET KVWLVLSVAV VLAVRISLTN RRLQADMKSS LSSSGVEPLV    120
AFVSLASGDG GLDDFFSETA TTDVTAQNLE YDFYRDTCPR AEKIVRTKMA WIYGQHRDVS    180
AQLLRLFFHD CFIEGCDASV LLDDSNGNQN HAIEKQAIPN RSLKGFDKID EIKERLENEC    240
PGVVSCADVL ALATRDAIVL AGGPFYPILT GRRDSTSSFF NEAMTGIPRP DDNINQTLHQ    300
FSLRGFDERE TVALLGGHNI GKIGCEFIMS RINNFKGTGQ PDPTIPPEFV TEMRLNCDDD    360
SNQATSNAAA AASPFVSRGL REKFTSQGMS YYQQLSSSFS TGAGFDSHYY QSLLRGRGLL    420
FADQQLMANK RTARVVTAYA SDGGSAFRMD FARAMMKMSV LNVLTGSQGE VRFDCSLPTP    480
SS*                                                                  540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00141peroxidase0.00441344230+
cd00314plant_peroxidase_like4.0e-20175459291+
pfam00141peroxidase3.0e-56165318155+
PLN03030PLN030306.0e-71137476344+
cd00693secretory_peroxidase1.0e-131148476329+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1qo4_A01494753300A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
PDB1pa2_A01494753300A Chain A, Arabidopsis Thaliana Peroxidase A2
PDB1sch_B01494752290A Chain A, Peanut Peroxidase
PDB1sch_A01494752290A Chain A, Peanut Peroxidase
PDB4a5g_B01494754301A Chain A, Raphanus Sativus Anionic Peroxidase.
Transmembrane Domains
StartEnd
8299
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_024_00148.1Aquca_020_00226.1Aquca_020_00219.1Aquca_020_00225.1
Arabidopsis lyrata857184
Arabidopsis thalianaAT4G33870.1
Brachypodium distachyonBradi2g48050.1
Brassica rapaBra011475Bra024033
Carica papayaevm.model.supercontig_34.24evm.model.supercontig_98.23
Capsella rubellaCarubv10004951mCarubv10006531m
Citrus clementinaCiclev10025449mCiclev10017909mCiclev10026177m
Citrus sinensisorange1.1g035578morange1.1g043399morange1.1g016209m
Cucumis sativusCucsa.239780.1
Eucalyptus grandisEucgr.F01472.1Eucgr.F03025.1
Fragaria vescamrna29957.1-v1.0-hybridmrna29954.1-v1.0-hybrid
Glycine maxGlyma08g17850.2Glyma15g41280.1
Malus domesticaMDP0000486228MDP0000254277
Manihot esculentacassava4.1_025400m
Medicago truncatulaMedtr4g012870.1
Mimulus guttatusmgv1a019717m
Oryza sativaLOC_Os01g51550.1
Panicum virgatumPavirv00060522m
Phaseolus vulgarisPhvul.005G059500.1Phvul.005G059700.1
Picea abiesMA_177017g0010
Populus trichocarpaPotri.007G067200.1Potri.007G067200.2Potri.001G182400.1
Prunus persicappa018541mppa007961m
Ricinus communis30146.m00360130169.m006321
Setaria italicaSi003773m
Selaginella moellendorffii115533
Sorghum bicolorSb04g019270.1
Thellungiella halophilaThhalv10025607mThhalv10027558m.213.419Thhalv10027558m.213.419
Vitis viniferaGSVIVT01010156001GSVIVT01017084001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny