y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna30095.1-v1.0-hybrid
FamilyCE8
Protein PropertiesLength: 436 Molecular Weight: 46844.1 Isoelectric Point: 7.5727
ChromosomeChromosome/Scaffold: 6 Start: 11981453 End: 11983915
Descriptionpectin methylesterase 44
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE81094040
  NVTVSQDGKGNFKLIMDAIKAAPSHSNNHYVILVKKGVYKEYVNIDQTKTNIVLMGEGKEATIISGSKSVGGGQQTFDSATFAVSAQGFVAIDIGFENTA
  GQKNMQAVAVLSAGDHAAFHRCKITGNQDTLLVHAGRQFFRECEIICTVDFIFGYGTAVFQKCNIYIRKNKIGGTSVISAHGRNSSTEASGFSFHDCAIN
  GDPQPPTNSSTHAGAYLGRNWGTFARTVFMHSTISNVVRPEGWLQWQSDPVDKLYFGEFQNSGPGAADGGRVKWPGFHQMTAADADKFTVAKFIDG
Full Sequence
Protein Sequence     Length: 436     Download
MVVVVVERKH KIGLLEPMGL VAVRLEGSAW FVGRVVDMGQ DIGLVSQETC KEVLDSTRRS    60
LEQVTTSIYQ ILDTLQVPQG TPDFCKASGA PILIGSTGPD DVKIPKTPNV TVSQDGKGNF    120
KLIMDAIKAA PSHSNNHYVI LVKKGVYKEY VNIDQTKTNI VLMGEGKEAT IISGSKSVGG    180
GQQTFDSATF AVSAQGFVAI DIGFENTAGQ KNMQAVAVLS AGDHAAFHRC KITGNQDTLL    240
VHAGRQFFRE CEIICTVDFI FGYGTAVFQK CNIYIRKNKI GGTSVISAHG RNSSTEASGF    300
SFHDCAINGD PQPPTNSSTH AGAYLGRNWG TFARTVFMHS TISNVVRPEG WLQWQSDPVD    360
KLYFGEFQNS GPGAADGGRV KWPGFHQMTA ADADKFTVAK FIDGNSWLPA LGIPFSPGVK    420
PSADPPKWGL EYSSS*                                                    480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02468PLN024681.0e-103106418314+
PLN03043PLN030439.0e-10694419330+
PLN02506PLN025067.0e-10844420398+
PLN02201PLN022011.0e-12437419416+
pfam01095Pectinesterase1.0e-137109405301+
Gene Ontology
GO TermDescription
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1gq8_A01084197319A Chain A, Pectin Methylesterase From Carrot
PDB1xg2_A01094194315B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB1qjv_B1e-2611341112341A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB1qjv_A1e-2611341112341A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB2ntq_B4e-2611341112341A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_033_00002.1Aquca_011_00390.1
Carica papayaevm.model.supercontig_116.69evm.model.supercontig_116.68
Capsella rubellaCarubv10003619m
Citrus clementinaCiclev10003835mCiclev10003723mCiclev10003299m
Citrus sinensisorange1.1g042946m
Fragaria vescamrna00944.1-v1.0-hybrid
Malus domesticaMDP0000217465MDP0000151159MDP0000258482MDP0000139083
Manihot esculentacassava4.1_022889mcassava4.1_021757mcassava4.1_022356m
Panicum virgatumPavirv00005884mPavirv00056856mPavirv00010344m
Prunus persicappa014833m
Setaria italicaSi015000mSi004506mSi033284m
Selaginella moellendorffii431592
Sorghum bicolorSb02g028740.1
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny