y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna30104.1-v1.0-hybrid
FamilyGT30
Protein PropertiesLength: 465 Molecular Weight: 52009.9 Isoelectric Point: 8.6712
ChromosomeChromosome/Scaffold: 6 Start: 12059282 End: 12063293
DescriptionKDO transferase A
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT30412200
  RWPERLGRPSFPRPPGPLLWFHAVSLGEGMSAIPVIKECIRKRPDLTILMTTTTSSAFEVIKNRLPTSVIHQFAPIDTPSAMETFLCHWKPNAIVLMESE
  LWPNLIIGASEKGIMLALLNARVSTKSFKRWSRPVLLPLISLMLSKFSLIAPLSTAQAIHFQLLCAPPFVINFSGDLKYV
Full Sequence
Protein Sequence     Length: 465     Download
MAATKGKLVY NIYRAVSHGL SPLLYLHLHW RKLRGLEHPL RWPERLGRPS FPRPPGPLLW    60
FHAVSLGEGM SAIPVIKECI RKRPDLTILM TTTTSSAFEV IKNRLPTSVI HQFAPIDTPS    120
AMETFLCHWK PNAIVLMESE LWPNLIIGAS EKGIMLALLN ARVSTKSFKR WSRPVLLPLI    180
SLMLSKFSLI APLSTAQAIH FQLLCAPPFV INFSGDLKYV VEEFDICEGE TRSIEDLTLH    240
LSHRQVWMAS SIHKGEEEVI LGIHKVLTQE YPDLFTIIVP RHPQHGKEIA QKLWREGHGV    300
ALRSQHHKLV EETNILVVDT LGELRHLYRL TPIAVIGGSF FPSLSGHNIS EAAAAGCAIL    360
TGPYVGHFSC MVLEMQRLNP LSVLQVSAGL ELEEALRKLL RDVKILEEHR VAAKQVYHAL    420
SGGIVGNVWN LLDFHILQRN LSLKNNEDQH AMGNLVASIC VPSH*                    480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam04413Glycos_transf_N9.0e-6338219184+
COG1519KdtA1.0e-10413369361+
PRK05749PRK057493.0e-11012369362+
Gene Ontology
GO TermDescription
GO:0005529Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates." [CHEBI:16646, GOC:mah]
GO:0005975carbohydrate metabolic process
GO:0016740transferase activity
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2xcu_D2e-245936543311A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47
PDB2xcu_C2e-245936543311A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47
PDB2xcu_B2e-245936543311A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47
PDB2xcu_A2e-245936543311A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47
PDB2xci_D2e-245936543311A Chain A, Membrane-Embedded Monofunctional Glycosyltransferase Waaa Of Aquifex Aeolicus, Substrate-Free Form
Hydropathy
Orthologous Group
SpeciesID
Arabidopsis lyrata325028
Arabidopsis thalianaAT5G03770.1
Brachypodium distachyonBradi2g55417.1
Brassica rapaBra009511
Carica papayaevm.model.supercontig_5.99
Capsella rubellaCarubv10000940m
Chlamydomonas reinhardtiiCre13.g583100.t1.3
Citrus clementinaCiclev10032390mCiclev10032645m
Cucumis sativusCucsa.039090.1
Eucalyptus grandisEucgr.A01566.1
Glycine maxGlyma10g07520.1
Gossypium raimondiiGorai.009G409200.3Gorai.009G409200.4Gorai.009G409200.2Gorai.009G409200.1
Linum usitatissimumLus10033622Lus10017663
Malus domesticaMDP0000133066
Manihot esculentacassava4.1_023442mcassava4.1_007754m
Medicago truncatulaMedtr1g061560.1
Mimulus guttatusmgv1a006467m
Oryza sativaLOC_Os01g63840.2LOC_Os01g63840.1
Panicum virgatumPavirv00040033mPavirv00069505m
Physcomitrella patensPp1s441_14V6.1
Phaseolus vulgarisPhvul.007G224100.1
Picea abiesMA_159008g0430
Populus trichocarpaPotri.016G095900.3Potri.016G095900.6Potri.016G095900.1Potri.016G095900.5Potri.016G095900.2
Potri.016G095900.4
Prunus persicappa025343m
Ricinus communis29815.m000507
Setaria italicaSi001596m
Selaginella moellendorffii76719
Sorghum bicolorSb03g040370.1
Thellungiella halophilaThhalv10013569m
Vitis viniferaGSVIVT01033751001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny