y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna30233.1-v1.0-hybrid
FamilyGH13
Protein PropertiesLength: 1190 Molecular Weight: 134737 Isoelectric Point: 5.2202
ChromosomeChromosome/Scaffold: 6 Start: 12554211 End: 12568767
Descriptionstarch branching enzyme 2.2
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1369110111.1e-28
  LPRIKKLGYNAVQLMAIQEHAYYASFGYHVTNFFAPSSRCGTPDDLKSLIDRAHELGLLVLMDIVHSHASNNTLDGLNMFDGTDSHYFHSGPRGYHWMWD
  SRLFNYGSWEVLRYLLSNARWWLEEFKFDGFRFDGVTSMMYTHHGLQVAFTGNYSEYFGLATDVDAVTYLMLVNDLIHGLYPEAISIGEDVSGMPAFCIP
  VADGGVGFDYRLHMAIADKWIELLQKMDEYWQMGDIVHTLTNRRWGEKCVAYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPTIDRGIALHKMIR
  LITMGLGGEGYLNFMGNEFGH
Full Sequence
Protein Sequence     Length: 1190     Download
MSDPKPRLVC CIGDIHGFHT KLQNLWSNLE SSTPSSDFAT ALIIFLGDYC DRGPETNKVL    60
DFLISLPSRY PRQKHVFIAG NHDFAFAAFL GVVPPPLDGS EFREGWREFE DNEEREGWFK    120
GEGYEGMHLQ GRRWAGRMTG FNKAKGTEYQ GSIYDAGPTF ESYGVPHGSA DLVKAVPDDH    180
KKFLANVVWV HEEDDVCVEI EGETKYYKLI AVHAGLEKDK DVKQQLEFLK ARDTRIPKIA    240
ALSGRKDVWN IPEELKNTPT VIVSGHHGKL HIEGLRLIID EGGGFAKNPV AAILLPSMKI    300
VHSANRDLDL ITNPTRKLKE EEEEEDGLDS LGDTLPSRPF RFQVLLAFQW RQSALHQPLP    360
VARQLLLFLS WDTMAFMLGV IPNMCLIRGK IFAGKSSYDS DSASSLTVAA SKKILVPGGP    420
SDGSPPLTEE LEAPDTDSED PQVLEDVDSV TMEDEKIEDE AISSLDVGSV DDETPSPLKA    480
TASTATKTIP PPGTGQKIYE IDPLLKGFRD HLDYRYGQYK RLREEIDKYE GGLEVFSRGY    540
EKFGFTRSAT GITYREWAPG AKSASLIGDF NNWNMNADVM TRNEFGVWEI FLPNNADGSP    600
AIPHGSRVKI RMDTPSGIKD SIPAWIKFSV QAPNEIPYNG IYYDPPEEEK YVFQHPQPNR    660
PQSLRIYEAH VGMSSTEPKI NSYAEFRDDV LPRIKKLGYN AVQLMAIQEH AYYASFGYHV    720
TNFFAPSSRC GTPDDLKSLI DRAHELGLLV LMDIVHSHAS NNTLDGLNMF DGTDSHYFHS    780
GPRGYHWMWD SRLFNYGSWE VLRYLLSNAR WWLEEFKFDG FRFDGVTSMM YTHHGLQVAF    840
TGNYSEYFGL ATDVDAVTYL MLVNDLIHGL YPEAISIGED VSGMPAFCIP VADGGVGFDY    900
RLHMAIADKW IELLQKMDEY WQMGDIVHTL TNRRWGEKCV AYAESHDQAL VGDKTIAFWL    960
MDKDMYDFMA LDRPSTPTID RGIALHKMIR LITMGLGGEG YLNFMGNEFG HPEWIDFPRG    1020
VQKLPNGKIV PGNNNSFDKC RRRFDLADAD YLRYHGLQEF DRAMHHLEET YSFMTSEHQY    1080
ISRKDEGDKV IVFERGNLVF VFNFHWSKSY SDYRVGCLKP GKYKIVLDSD ESIFGGFNRI    1140
DHTADYFTVD GWYDERPNSF QLYAPCRTAV VYALVESKET SKEKKPIKG*               1200
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02960PLN029606.0e-950659293+
cd07421MPP_Rhilphs3.0e-1786309305+
PLN02447PLN0244704251187767+
cd11321AmyAc_bac_euk_BE06471062417+
PLN02960PLN0296006001175580+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0016787hydrolase activity
GO:0043169cation binding
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3amk_A0498117613694A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB3aml_A0498117613694A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB3vu2_B0498117613694A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB3vu2_A0498117613694A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB3k1d_A0492117088717A Chain A, Crystal Structure Of Glycogen Branching Enzyme Synonym: 1,4- Glucan:1,4-Alpha-D-Glucan 6-Glucosyl-Transferase From Mycob Tuberculosis H3
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_066_00053.1Aquca_027_00415.5Aquca_027_00415.4Aquca_027_00415.3Aquca_027_00415.2
Aquca_027_00415.1Aquca_015_00400.6Aquca_015_00400.5Aquca_015_00400.2Aquca_015_00400.1
Aquca_015_00400.3Aquca_015_00400.4
Arabidopsis lyrata873536321348908239
Arabidopsis thalianaAT3G20440.3AT3G20440.2AT2G36390.1AT5G03650.1
Brachypodium distachyonBradi1g41970.2Bradi1g41970.1Bradi1g29850.2Bradi1g29850.1Bradi5g09170.2
Bradi5g09170.1Bradi3g44760.1
Brassica rapaBra035782Bra005269Bra017241Bra009521
Carica papayaevm.model.supercontig_5.62
Capsella rubellaCarubv10012936mCarubv10022617mCarubv10000235m
Chlamydomonas reinhardtiiCre06.g270100.t1.3Cre10.g444700.t1.1Cre06.g289850.t1.3Cre08.g373450.t1.1
Citrus clementinaCiclev10007401mCiclev10011063mCiclev10000406mCiclev10000374mCiclev10000272m
Ciclev10000256m
Citrus sinensisorange1.1g035501morange1.1g002609morange1.1g004765morange1.1g004253morange1.1g003474m
orange1.1g003390morange1.1g003230morange1.1g003226m
Cucumis sativusCucsa.378410.2Cucsa.378410.1Cucsa.077550.3Cucsa.077550.1Cucsa.077550.2
Eucalyptus grandisEucgr.F03487.1Eucgr.A01533.1Eucgr.F01770.1
Fragaria vescamrna08644.1-v1.0-hybridmrna08646.1-v1.0-hybrid
Glycine maxGlyma18g10385.1Glyma03g35020.2Glyma03g35020.1Glyma19g37750.2Glyma19g37750.1
Glyma04g01950.2
Gossypium raimondiiGorai.009G406400.4Gorai.011G196000.5Gorai.011G196000.4Gorai.011G196000.3Gorai.011G196000.2
Gorai.011G196000.12Gorai.011G196000.1Gorai.011G196000.7Gorai.011G196000.6Gorai.011G196000.13
Gorai.002G172100.7Gorai.002G172100.5Gorai.002G172100.3Gorai.002G172100.2Gorai.002G172100.1
Gorai.009G441800.2Gorai.009G441800.1Gorai.009G406400.6Gorai.009G406400.5Gorai.009G406400.3
Gorai.009G406400.2Gorai.009G406400.1Gorai.002G241400.7Gorai.002G241400.6Gorai.002G241400.5
Gorai.002G241400.4Gorai.002G241400.2Gorai.002G241400.1Gorai.005G113800.3Gorai.005G113800.2
Gorai.005G113800.1
Linum usitatissimumLus10000912Lus10023878Lus10014382Lus10016012Lus10012264
Malus domesticaMDP0000218396MDP0000148418MDP0000214735MDP0000177786
Manihot esculentacassava4.1_006199mcassava4.1_004366mcassava4.1_003773mcassava4.1_001701mcassava4.1_001686m
cassava4.1_002337mcassava4.1_002172mcassava4.1_002171mcassava4.1_001826mcassava4.1_001598m
cassava4.1_001595m
Medicago truncatulaMedtr7g104080.1
Mimulus guttatusmgv1a001162mmgv1a001301mmgv1a001932m
Oryza sativaLOC_Os02g32660.2LOC_Os06g26234.3LOC_Os06g26234.2LOC_Os06g26234.1LOC_Os02g32660.1
LOC_Os06g51084.8LOC_Os06g51084.7LOC_Os06g51084.6LOC_Os06g51084.5LOC_Os06g51084.4
LOC_Os06g51084.3LOC_Os06g51084.2LOC_Os06g51084.1
Panicum virgatumPavirv00035568mPavirv00058932mPavirv00002278mPavirv00067040mPavirv00061484m
Pavirv00061483mPavirv00061485m
Physcomitrella patensPp1s200_23V6.1Pp1s15_181V6.2Pp1s15_181V6.1Pp1s54_189V6.2Pp1s54_189V6.1
Pp1s64_78V6.1
Phaseolus vulgarisPhvul.006G047000.1Phvul.001G187600.1Phvul.009G011000.1
Picea abiesMA_10430611g0010
Populus trichocarpaPotri.006G115100.5Potri.001G359200.1Potri.006G115100.6Potri.006G115100.4Potri.006G115100.3
Potri.006G115100.2Potri.006G115100.1Potri.005G251000.5Potri.005G251000.4Potri.005G251000.3
Potri.005G251000.2Potri.005G251000.1Potri.005G251000.6
Prunus persicappa016544mppa001312mppa001929m
Ricinus communis29762.m00048630170.m01435927496.m000095
Setaria italicaSi008087mSi016350mSi009379mSi009312mSi005911m
Si006006mSi006081m
Selaginella moellendorffii165481437348437417
Sorghum bicolorSb03g027310.1Sb04g021540.1Sb06g015360.1Sb10g030776.1
Thellungiella halophilaThhalv10020019mThhalv10016249mThhalv10012785mThhalv10012784mThhalv10012679m
Vitis viniferaGSVIVT01037695001GSVIVT01033801001GSVIVT01008673001
Volvox carteriVocar20012173mVocar20015251mVocar20002436mVocar20007338m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)