y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna30256.1-v1.0-hybrid
FamilyCE16
Protein PropertiesLength: 445 Molecular Weight: 48307 Isoelectric Point: 7.6558
ChromosomeChromosome/Scaffold: 6 Start: 12696697 End: 12708790
DescriptionGDSL-like Lipase/Acylhydrolase superfamily protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE161354271.1e-21
  LFVFGDSYSDTGNNIKSVTKSWKYPYGITFPGRPTGRFSDGRVLTDYLAKFVGVRSPIPYKFRNVGVKHLKYGMNFAYGGTGVFNTLVAAPNMTTQIDFF
  QQFIKDSVFNAQDLHSSVALITLAGNDYAYYLALNNSSEGFKPFITSVVNQLSVNLKRVYDLGVKKIVVTALQPLGCLPGSTAEFSFQKCNGTQNLLVGF
  HNLLLQQAVAKLNNETKSSFFVLDLYTSFMSVLKNNGNHLGSIKFENPLKPCCVGISSKYDCGSVDDSGAKKYTICDDPASAFFWDGAHPTQQ
Full Sequence
Protein Sequence     Length: 445     Download
MSSDRLRQPL RSRSVGLRPS FLPEVESDHL GVAVVVVGAL VGGAEADEGA GGAGGAGDAA    60
VDVVVVLDVA AGGAQSFLFL SESMELAQTL FLPLLLCLLF LLTQQSASLV SAGHHHHHHH    120
HPTHRHLFDW RPTKLFVFGD SYSDTGNNIK SVTKSWKYPY GITFPGRPTG RFSDGRVLTD    180
YLAKFVGVRS PIPYKFRNVG VKHLKYGMNF AYGGTGVFNT LVAAPNMTTQ IDFFQQFIKD    240
SVFNAQDLHS SVALITLAGN DYAYYLALNN SSEGFKPFIT SVVNQLSVNL KRVYDLGVKK    300
IVVTALQPLG CLPGSTAEFS FQKCNGTQNL LVGFHNLLLQ QAVAKLNNET KSSFFVLDLY    360
TSFMSVLKNN GNHLGSIKFE NPLKPCCVGI SSKYDCGSVD DSGAKKYTIC DDPASAFFWD    420
GAHPTQQGWL AVYSALQATL EELY*                                          480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3240COG32403.0e-11133441337+
cd01847Triacylglycerol_lipase_like3.0e-12132428310+
PLN03156PLN031563.0e-26135427320+
cd01846fatty_acyltransferase_like1.0e-28134428298+
cd01837SGNH_plant_lipase_like5.0e-89135436317+
Gene Ontology
GO TermDescription
GO:0006629lipid metabolic process
GO:0016788hydrolase activity, acting on ester bonds
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_072_00172.1
Linum usitatissimumLus10003253Lus10035600
Physcomitrella patensPp1s126_111V6.1
Ricinus communis29625.m000675
Vitis viniferaGSVIVT01033808001GSVIVT01011247001GSVIVT01011220001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny