y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna30795.1-v1.0-hybrid
FamilyGH28
Protein PropertiesLength: 323 Molecular Weight: 35058.1 Isoelectric Point: 4.4897
ChromosomeChromosome/Scaffold: 1 Start: 2958020 End: 2959740
DescriptionPectin lyase-like superfamily protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH281302771.2e-36
  GSTQDIPTLIIPKDNNFLLSSVEFKGPCKAASVNFQLNGNIVAPNDTNAWGDNKGRWVQFDQVQGLIINEGGQIDGQGQALHFDSCDGLRLSNITHINSA
  KNHITITSCNDVQISDILIRAPDESPNTDGINISTSTNITIQRSFIGT
Full Sequence
Protein Sequence     Length: 323     Download
MEGRVVAMIF LLMIILVASP SPSSCARLNG FPTTTTLRDD DSIGVYGDQV ATVTSNSFNN    60
KKYGDVFATP YRFHEYRPLS SSQTSDDLQA FPEADGTSTF NVMNYGAIGN DQFDNTQVCL    120
SESMGIDVCG STQDIPTLII PKDNNFLLSS VEFKGPCKAA SVNFQLNGNI VAPNDTNAWG    180
DNKGRWVQFD QVQGLIINEG GQIDGQGQAL HFDSCDGLRL SNITHINSAK NHITITSCND    240
VQISDILIRA PDESPNTDGI NISTSTNITI QRSFIGTDAG IGPRLVAIWS NQKQRLYAFL    300
PTPNISLEDV SCKQERDRNA AK*                                            360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02218PLN022182.0e-2072312265+
PLN02188PLN021881.0e-2484277213+
PLN02793PLN027931.0e-25100259181+
PLN03003PLN030032.0e-3297312227+
PLN03010PLN030108.0e-42100259165+
Gene Ontology
GO TermDescription
GO:0004650polygalacturonase activity
GO:0005975carbohydrate metabolic process
Signal Peptide
Cleavage Site
25
Hydropathy
Orthologous Group
SpeciesID
Brassica rapaBra040077
Citrus sinensisorange1.1g047411m
Glycine maxGlyma08g25901.1Glyma17g31721.1
Gossypium raimondiiGorai.011G082300.1
Malus domesticaMDP0000600336MDP0000146841
Prunus persicappa021254m.37.202ppa021254m.37.202
Vitis viniferaGSVIVT01017354001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny