y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna30947.1-v1.0-hybrid
FamilyGT1
Protein PropertiesLength: 463 Molecular Weight: 49550.9 Isoelectric Point: 6.2417
ChromosomeChromosome/Scaffold: 1 Start: 1820674 End: 1822758
DescriptionUDP-glucosyl transferase 78D2
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12604364.79945e-42
  PLLEDDSGCLEWLDKHKPASVVYISFGSVVSPPPHELAAFAEALAESGFPFIWSFRGNPDEILPNGCDKSSLNGKIVSWAPQVQILEHAAVGVFVTHCGW
  NSILESIVGGVPMICRPFFGDQNLNMKTVEAVWGIGVGIEGGVLTKQGAVKALELILRGEAGNEMREKIKVLRSLAR
Full Sequence
Protein Sequence     Length: 463     Download
MAGQNPKQPS TQYHHHVAAL AFPFGTHAGP LLSLVLRLAA AKPDTIFSFI TTSKANSSLF    60
SQTSKASAFL NVKAYDVPDG LPEGFVPSGH PEQLIGFFLK AAPANFRIVM KEAEAGSGLK    120
IGCLVTDAFF WFAGDMAEEM KLPWVPLWTA GSRSLLVHAA TDLIRQRVLG TGGNAVKTLE    180
FLPGFSKLEV ADLPEGVVLG NLESPISSLL HKMGQELPKA TAVAINSFEE AEPDVVNELK    240
SRFKKFLNVG PFNLASASPP LLEDDSGCLE WLDKHKPASV VYISFGSVVS PPPHELAAFA    300
EALAESGFPF IWSFRGNPDE ILPNGCDKSS LNGKIVSWAP QVQILEHAAV GVFVTHCGWN    360
SILESIVGGV PMICRPFFGD QNLNMKTVEA VWGIGVGIEG GVLTKQGAVK ALELILRGEA    420
GNEMREKIKV LRSLARSAVE DNGSSSKAFN SLVNIVTKHE EV*                      480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02210PLN022104.0e-4016457466+
PLN02555PLN025552.0e-4014462495+
PLN03007PLN030071.0e-4314453488+
PLN02448PLN024488.0e-4416458481+
PLN02410PLN024101.0e-4517456451+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3hbj_A01645715453A Chain A, X-Ray Structure Of 119-141 Znua Deletion Mutant From Salmonella Enterica
PDB3hbf_A01645715453A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp
PDB2c9z_A0114624456A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp
PDB2c1z_A0114624456A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp
PDB2c1x_A0114624456A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_031_00073.1Aquca_031_00072.1
Arabidopsis lyrata488567326139313693488566
Arabidopsis thalianaAT5G17040.1AT1G30530.1AT5G17050.1AT5G17030.1
Brachypodium distachyonBradi1g46850.1
Brassica rapaBra023594
Carica papayaevm.model.supercontig_95.70
Capsella rubellaCarubv10000798m
Citrus clementinaCiclev10008258mCiclev10019770mCiclev10030331m
Citrus sinensisorange1.1g012893morange1.1g013878m
Cucumis sativusCucsa.092240.1Cucsa.089640.1
Eucalyptus grandisEucgr.A02964.3Eucgr.A02964.1Eucgr.E02976.1Eucgr.E02345.1Eucgr.I02607.1
Eucgr.E02973.1Eucgr.E02977.1Eucgr.C00191.1Eucgr.A02964.2Eucgr.E02398.1
Eucgr.C01022.1Eucgr.C00833.1Eucgr.A00303.1Eucgr.A00306.1Eucgr.C01021.1
Eucgr.C01020.1Eucgr.C01017.1Eucgr.D00702.1Eucgr.C00831.1Eucgr.L02741.1
Eucgr.L02520.1Eucgr.C01063.1Eucgr.E02978.1Eucgr.A00304.1
Fragaria vescamrna12591.1-v1.0-hybridmrna19962.1-v1.0-hybridmrna24693.1-v1.0-hybridmrna11466.1-v1.0-hybridmrna11467.1-v1.0-hybrid
mrna13747.1-v1.0-hybridmrna29614.1-v1.0-hybrid
Glycine maxGlyma07g30200.1Glyma13g01220.1Glyma07g30180.1Glyma08g07130.1Glyma07g30190.1
Glyma13g32910.1Glyma17g07341.1Glyma15g06390.1Glyma06g39350.2Glyma0060s00320.2
Gossypium raimondiiGorai.003G051800.1Gorai.004G101100.1Gorai.012G009400.1Gorai.012G009300.1Gorai.012G009500.1
Gorai.010G063400.1Gorai.009G050700.1Gorai.008G018000.1
Linum usitatissimumLus10025854
Malus domesticaMDP0000543445MDP0000638691MDP0000478252MDP0000405936
Manihot esculentacassava4.1_007209mcassava4.1_031308mcassava4.1_033139mcassava4.1_028603m
Medicago truncatulaMedtr4g128690.1Medtr4g128720.1
Mimulus guttatusmgv1a006133mmgv1a006788m
Oryza sativaLOC_Os06g09240.1LOC_Os07g05420.1
Panicum virgatumPavirv00029337mPavirv00050970mPavirv00041516mPavirv00063020m
Phaseolus vulgarisPhvul.006G201100.1Phvul.002G214500.1Phvul.003G148300.1Phvul.002G214300.1Phvul.002G214400.1
Populus trichocarpaPotri.013G118700.1Potri.018G096000.1Potri.006G171100.1Potri.006G171200.1Potri.013G143900.1
Potri.009G133300.1Potri.009G078400.1Potri.019G090400.1
Prunus persicappa015939mppa019430mppa015221mppa017941mppa005162m
Ricinus communis28479.m00004729804.m00155830073.m002239
Setaria italicaSi006338mSi010039m
Selaginella moellendorffii105043445660
Sorghum bicolorSb10g006140.1Sb02g038860.1
Thellungiella halophilaThhalv10013472m
Vitis viniferaGSVIVT01037410001GSVIVT01037413001GSVIVT01029129001GSVIVT01029126001GSVIVT01029122001
GSVIVT01024419001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)